Gene

KWMTBOMO01977

Pre Gene Modal

BGIBMGA014037

Annotation

PREDICTED:_F-box/SPRY_domain-containing_protein_1_[Papilio_machaon]

Location

Bomo_Chr4(-):8988872-8991431      View in EpiBrowser

Full name

F-box/SPRY domain-containing protein 1      

Location in the cell

Nuclear   Reliability : 3.913

CDS

ATGCTCAGTGATGAGAATAATGAAGTGTGGAGATATCATTGTTATAGAAGATTAACAGAAGAAATGATGAAATCTGATTTACTTTCGTGCCTCAGAACTTATAGAGAAAAACTTAGAGCATATTGCCATGCTTGGAATCCGTATGATTGTTCGAGAAACATTTATATCAAACCAAATGGATTTACTTTACACAGAAATCCTGTAGCACAGAGTACAGATGCTTGTAGAGGAAAGGTTGGATTTTATCGTGGTCGTCATGCTTGGGAAATTATATGGGAAGGTCCCCTTGGCACAGTAGCTGTCATAGGGGTGTCAACTAGAGATGCACCATTGCAATGTCAAGGATATGTAGGATTGCTTGGTTCAGATGAACTGAGTTGGGGCTGGAATCTTGTTGATAATCATTTATTACACAATGGTGATACTCAAGGACACTATCCATTGTTAAATAACTGCCCCAAATATCAAGTTGGTGAAAGAATAAGAGTGATACTTGATTGTGATCGTCACACCCTCTCATTTGAAAGGAATTATGAATTTTTAGGTGTTGCATTCCGTGGTCTACCCAATAAAAGACTTTATCCAACTATATCAGCAGTGTATGGAAATACAGAAGTTTCTATGGTGTATGTAGGTCCTCCGCTAGATGGCTGA

Protein

MLSDENNEVWRYHCYRRLTEEMMKSDLLSCLRTYREKLRAYCHAWNPYDCSRNIYIKPNGFTLHRNPVAQSTDACRGKVGFYRGRHAWEIIWEGPLGTVAVIGVSTRDAPLQCQGYVGLLGSDELSWGWNLVDNHLLHNGDTQGHYPLLNNCPKYQVGERIRVILDCDRHTLSFERNYEFLGVAFRGLPNKRLYPTISAVYGNTEVSMVYVGPPLDG

Description

Required in the presynaptic motoneuron to down-regulate the levels of wnd and restrain synaptic terminal growth at the neuromuscular junction (NMJ).
Required in the presynaptic motoneuron to down-regulate the levels of wnd and restrain synaptic terminal growth at the neuromuscular junction (NMJ). Negatively regulates the localization of vas to the posterior pole of the oocyte. Involved in primordial germ cell formation.

Subunit

Component of an E3 ubiquitin ligase complex composed of hiw and Fsn.
Component of an E3 ubiquitin ligase complex composed of hiw and Fsn (PubMed:17697379, PubMed:21874015). Interacts with Rae1, probably as part of the hiw-Fsn complex (PubMed:21874015). Interacts (via B30.2/SPRY domain) with vas (PubMed:20123973). Interacts with Cul1 (PubMed:20123973).

Similarity

Belongs to the FBXO45/Fsn family.

Keywords

Cell junction   Complete proteome   Neurogenesis   Reference proteome   Synapse   Ubl conjugation pathway   Cell projection   Cytoplasm   Developmental protein   Direct protein sequencing   Nucleus  

Feature

chain  F-box/SPRY domain-containing protein 1

Uniprot

A0A2A4K1D6   A0A1E1WSG0   A0A194PK52   H9JWX3   A0A0L7K4H2   D6WKT0   + More
S4PA62   A0A1W4WPN3   A0A2P8Z471   A0A067QXZ8   A0A146LHC4   A0A1B6CJL1   A0A1Y1KVG9   A0A2J7RPJ5   A0A1B6I615   A0A1B6M3M6   A0A023F3T8   A0A026VZ20   A0A1B0D3R9   A0A195CJ84   A0A195DFY8   F4X3J6   A0A195BMW8   A0A195EY44   A0A158NRN1   E2A8E3   A0A151X8U3   E2BTU2   A0A1L8DTH9   A0A2A3E6F4   A0A087ZUP8   A0A0N0BBH3   N6TN04   A0A1A9X2G3   A0A1A9XXV4   A0A1B0ARC6   D3TQ29   A0A1A9VQ78   A0A1B0ADD2   B4J6Q0   A0A1I8N4Z7   E0VER1   T1P8I3   B4LMQ3   A0A0N7ZD13   B4KNC5   A0A1I8P3F3   T1IWF8   T1I9K1   B4MR59   B3MDR0   A0A154P840   A0A0M3QUL1   A0A0J9RBS6   B4QE02   B3NRP1   A0A034WN20   E9H8D8   A0A1W4UNV0   A0A0K8TYH8   Q9V6L9   B4HQ29   W8BX69   B4P4K8   A0A0P5G7U1   A0A0P6H3E9   A0A0Q5VN08   A0A336MFF7   A0A194RBC7   Q290L5   B4GBN7   A0A3B0J720   A0A212ELR6   A0A0L7R2W4   A0A210R6Z8   A0A2R7X0C4   A0A3Q0JD11   A0A2R5LKS3   B7QEK9   V5I0E7   A0A2C9JNL4   A0A1Q3EZK0   B0X9V1   U5EVC0   A0A1E1XDP1   A0A182H559   Q16XV7   A0A2K7P6B6   L7M5X8   A0A087UXD1   A0A224Z212   A0A0B6Y978   A0A1S3K8F6   A0A023GH76   G3MIB3   A0A131XK41   A0A2P6LC14   D3PG63   A0A182MNR3   A0A084W6T8  

Pubmed

26354079    19121390    26227816    18362917    19820115    23622113    + More
29403074    24845553    26823975    28004739    25474469    24508170    30249741    21719571    21347285    20798317    23537049    20353571    17994087    25315136    20566863    22936249    25348373    21292972    10731132    12537572    12537569    17697379    20123973    21874015    24495485    15632085    22118469    28812685    25765539    15562597    28503490    26483478    17510324    25576852    28797301    22216098    28049606    24438588   

EMBL

NWSH01000276    PCG77836.1    GDQN01001303    JAT89751.1    KQ459601    KPI93816.1    + More
BABH01042590    BABH01042591    BABH01042592    JTDY01010529    KOB58178.1    KQ971342    EFA03038.1    GAIX01003389    JAA89171.1    PYGN01000204    PSN51293.1    KK852829    KDR15350.1    GDHC01019879    GDHC01011016    JAP98749.1    JAQ07613.1    GEDC01023783    JAS13515.1    GEZM01075282    JAV64160.1    NEVH01001358    PNF42762.1    GECU01025344    GECU01014849    JAS82362.1    JAS92857.1    GEBQ01017996    GEBQ01009464    JAT21981.1    JAT30513.1    GBBI01002651    JAC16061.1    KK107575    QOIP01000011    EZA48701.1    RLU17201.1    AJVK01023668    KQ977649    KYN00778.1    KQ980886    KYN11808.1    GL888613    EGI59024.1    KQ976439    KYM86670.1    KQ981931    KYN32804.1    ADTU01024191    GL437573    EFN70293.1    KQ982409    KYQ56782.1    GL450531    EFN80841.1    GFDF01004377    JAV09707.1    KZ288351    PBC27343.1    KQ436126    KOX67438.1    APGK01017423    KB740026    KB632163    ENN81894.1    ERL89272.1    JXJN01002325    EZ423531    ADD19807.1    CH916367    EDW00953.1    DS235093    EEB11867.1    KA645051    AFP59680.1    CH940648    EDW60994.1    GDRN01055454    JAI65968.1    CH933808    EDW09978.1    JH431613    ACPB03001383    CH963849    EDW74598.1    CH902619    EDV36445.1    KQ434839    KZC08037.1    CP012524    ALC40859.1    CM002911    KMY93446.1    CM000362    EDX06896.1    CH954179    EDV56193.1    GAKP01003250    JAC55702.1    GL732604    EFX71963.1    GDHF01032775    JAI19539.1    AE013599    AY118594    AAM49963.1    AAM68601.1    CH480816    EDW47692.1    GAMC01002693    JAC03863.1    CM000158    EDW90647.1    GDIQ01249962    GDIP01135004    GDIQ01088914    JAK01763.1    JAL68710.1    GDIQ01024665    JAN70072.1    KQS62759.1    UFQT01001098    SSX28916.1    KQ460398    KPJ15133.1    CM000071    EAL25347.1    CH479181    EDW32295.1    OUUW01000001    SPP75662.1    AGBW02013994    OWR42426.1    KQ414663    KOC65217.1    NEDP02000107    OWF56708.1    KK856232    PTY25247.1    GGLE01005912    MBY10038.1    ABJB010460987    DS921462    EEC17281.1    GANP01001991    GEFM01002529    JAB82477.1    JAP73267.1    GFDL01014315    JAV20730.1    DS232551    EDS43303.1    GANO01001101    JAB58770.1    GFAC01001947    JAT97241.1    JXUM01035283    JXUM01035284    JXUM01110890    JXUM01110891    KQ565452    KQ561053    KXJ70952.1    KXJ79866.1    CH477532    GACK01005762    JAA59272.1    KK122149    KFM82020.1    GFPF01012059    MAA23205.1    HACG01005874    CEK52739.1    GBBM01002189    JAC33229.1    JO841614    AEO33231.1    GEFH01002680    JAP65901.1    MWRG01000435    PRD36127.1    BT120619    BT121541    ADD24259.1    ADD38471.1    AXCM01011913    ATLV01020948    KE525310    KFB45932.1   

Proteomes

UP000218220    UP000053268    UP000005204    UP000037510    UP000007266    UP000192223    + More
UP000245037    UP000027135    UP000235965    UP000053097    UP000279307    UP000092462    UP000078542    UP000078492    UP000007755    UP000078540    UP000078541    UP000005205    UP000000311    UP000075809    UP000008237    UP000242457    UP000005203    UP000053105    UP000019118    UP000030742    UP000091820    UP000092443    UP000092460    UP000078200    UP000092445    UP000001070    UP000095301    UP000009046    UP000008792    UP000009192    UP000095300    UP000015103    UP000007798    UP000007801    UP000076502    UP000092553    UP000000304    UP000008711    UP000000305    UP000192221    UP000000803    UP000001292    UP000002282    UP000053240    UP000001819    UP000008744    UP000268350    UP000007151    UP000053825    UP000242188    UP000079169    UP000001555    UP000076420    UP000002320    UP000069940    UP000249989    UP000008820    UP000054359    UP000085678    UP000075883    UP000030765   

PRIDE

H9JWX3    Q9V6L9    V5I0E7   

Pfam

PF00622   SPRY        + More
PF12937   F-box-like
PF00646   F-box

Interpro

IPR035784   SPRY_FBXO45        + More
IPR001810   F-box_dom       
IPR003877   SPRY_dom       
IPR013320   ConA-like_dom_sf       
IPR036047   F-box-like_dom_sf       
IPR001870   B30.2/SPRY       

SUPFAM

SSF81383   SSF81383        + More
SSF49899   SSF49899       

CDD

cd12907  SPRY_Fbox

ProteinModelPortal

A0A2A4K1D6   A0A1E1WSG0   A0A194PK52   H9JWX3   A0A0L7K4H2   D6WKT0   + More
S4PA62   A0A1W4WPN3   A0A2P8Z471   A0A067QXZ8   A0A146LHC4   A0A1B6CJL1   A0A1Y1KVG9   A0A2J7RPJ5   A0A1B6I615   A0A1B6M3M6   A0A023F3T8   A0A026VZ20   A0A1B0D3R9   A0A195CJ84   A0A195DFY8   F4X3J6   A0A195BMW8   A0A195EY44   A0A158NRN1   E2A8E3   A0A151X8U3   E2BTU2   A0A1L8DTH9   A0A2A3E6F4   A0A087ZUP8   A0A0N0BBH3   N6TN04   A0A1A9X2G3   A0A1A9XXV4   A0A1B0ARC6   D3TQ29   A0A1A9VQ78   A0A1B0ADD2   B4J6Q0   A0A1I8N4Z7   E0VER1   T1P8I3   B4LMQ3   A0A0N7ZD13   B4KNC5   A0A1I8P3F3   T1IWF8   T1I9K1   B4MR59   B3MDR0   A0A154P840   A0A0M3QUL1   A0A0J9RBS6   B4QE02   B3NRP1   A0A034WN20   E9H8D8   A0A1W4UNV0   A0A0K8TYH8   Q9V6L9   B4HQ29   W8BX69   B4P4K8   A0A0P5G7U1   A0A0P6H3E9   A0A0Q5VN08   A0A336MFF7   A0A194RBC7   Q290L5   B4GBN7   A0A3B0J720   A0A212ELR6   A0A0L7R2W4   A0A210R6Z8   A0A2R7X0C4   A0A3Q0JD11   A0A2R5LKS3   B7QEK9   V5I0E7   A0A2C9JNL4   A0A1Q3EZK0   B0X9V1   U5EVC0   A0A1E1XDP1   A0A182H559   Q16XV7   A0A2K7P6B6   L7M5X8   A0A087UXD1   A0A224Z212   A0A0B6Y978   A0A1S3K8F6   A0A023GH76   G3MIB3   A0A131XK41   A0A2P6LC14   D3PG63   A0A182MNR3   A0A084W6T8  

PDB

6DN8     E-value=2.76604e-40,     Score=412

KEGG

101746270    K10319 F-box protein 45 | (RefSeq) F-box/SPRY domain-containing protein 1

GO

GO:0043161   GO:0045202   GO:0019005   GO:0060386   GO:0006511   GO:0005634   GO:0016567   GO:0045886   GO:0045495   GO:0005938   GO:0007274   GO:0007399   GO:0030054   GO:0010629   GO:0031594   GO:0045732   GO:0005737   GO:0043204   GO:0030424   GO:0031146   GO:0005515   GO:0005581   GO:0016020   GO:0051013   GO:0008168   GO:0016876   GO:0043039   GO:0004651  

Subcellular location

  
Cytoplasm   In mid- to late-stage oocytes, recruited to the pole plasm. This posterior distribution is not maintained in later developmental stages. Some cortical accumulation is observed at mid- to late-stage oocytes. In mature eggs, present at high levels throughout the ooplasm.   With evidence from 6 publications.
Nucleus   In mid- to late-stage oocytes, recruited to the pole plasm. This posterior distribution is not maintained in later developmental stages. Some cortical accumulation is observed at mid- to late-stage oocytes. In mature eggs, present at high levels throughout the ooplasm.   With evidence from 6 publications.
Cell junction   In mid- to late-stage oocytes, recruited to the pole plasm. This posterior distribution is not maintained in later developmental stages. Some cortical accumulation is observed at mid- to late-stage oocytes. In mature eggs, present at high levels throughout the ooplasm.   With evidence from 6 publications.
Synapse   In mid- to late-stage oocytes, recruited to the pole plasm. This posterior distribution is not maintained in later developmental stages. Some cortical accumulation is observed at mid- to late-stage oocytes. In mature eggs, present at high levels throughout the ooplasm.   With evidence from 6 publications.
Cell projection   In mid- to late-stage oocytes, recruited to the pole plasm. This posterior distribution is not maintained in later developmental stages. Some cortical accumulation is observed at mid- to late-stage oocytes. In mature eggs, present at high levels throughout the ooplasm.   With evidence from 6 publications.
Axon   In mid- to late-stage oocytes, recruited to the pole plasm. This posterior distribution is not maintained in later developmental stages. Some cortical accumulation is observed at mid- to late-stage oocytes. In mature eggs, present at high levels throughout the ooplasm.   With evidence from 6 publications.
Perikaryon   In mid- to late-stage oocytes, recruited to the pole plasm. This posterior distribution is not maintained in later developmental stages. Some cortical accumulation is observed at mid- to late-stage oocytes. In mature eggs, present at high levels throughout the ooplasm.   With evidence from 6 publications.

Length:

217

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.0882100000000001

Exp number, first 60 AAs:

0

Total prob of N-in:

0.06053

outside

1  -  217

 

 

Pi

198.215543

Theta

186.961669

Tajima's D

0.127016

CLR

42.64169

CSRT

0.409179541022949

Interpretation

Uncertain