SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01942
Pre Gene Modal
BGIBMGA006113
Annotation
PREDICTED:_uncharacterized_protein_LOC105842570_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.695
 

Sequence

CDS
ATGCCTGAAGGCAAAGTAAAAGACTTAATTAAAAGGAGGGCCTCAATAAAGGCCAAAATAACACAATTCTCTACGTATTTGGATGTCCTACGGGGTTGTGATTATCTCAATGATGTGCAATTCTCGGAACTCCAAGTACGTCTTGAGAAATTCGAAACCTTATACGGGGACTTCGACACTTTTCAGAGTGAGATCGAGATGCTGTCAGACGCGCCGGAAGACCATTATAAGGATCGTGAGTCCATTGAGTCGCAGTACTACAAGCTTGTGGCTTCTGCGCGTACGCTGTTGGATCAACGCAAAAATAATGACGGTAGGTCCGAGAGATTCCAGCGTATCGAGTACCTTAAGCAGCATTTTTGGCAGCGATTCTCCAATGAGTACGTCGTGTGGCTACAACAAAAAATTAAATGGCCGACTCAAAAGGGAGACTTAAAAGAAGGTATGATGGTTGTCATCAAGGAGAAGGGACTACCACCTCTTATGTGGCTGCTCGGACGCATTATTCGCCTTTGTCCTGGACGAGATGGAATTACACGTGTGGCAGATATCTTAACCAAGAAAGGTGTTATACGACGCGCTTACAACAACATATGCCCGCTACCAGTCAATATTTGA
Protein
MPEGKVKDLIKRRASIKAKITQFSTYLDVLRGCDYLNDVQFSELQVRLEKFETLYGDFDTFQSEIEMLSDAPEDHYKDRESIESQYYKLVASARTLLDQRKNNDGRSERFQRIEYLKQHFWQRFSNEYVVWLQQKIKWPTQKGDLKEGMMVVIKEKGLPPLMWLLGRIIRLCPGRDGITRVADILTKKGVIRRAYNNICPLPVNI

Summary

Pfam
PF18701   DUF5641        + More
PF00665   rve
PF17921   Integrase_H2C2
PF05585   DUF1758
PF03564   DUF1759
PF05380   Peptidase_A17
Interpro
IPR040676   DUF5641        + More
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR036397   RNaseH_sf       
IPR001606   ARID_dom       
IPR005312   DUF1759       
IPR041588   Integrase_H2C2       
IPR008737   Peptidase_asp_put       
IPR008042   Retrotrans_Pao       
SUPFAM
SSF53098   SSF53098       
Gene 3D

Ontologies

Topology

Length:
205
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00232
Exp number, first 60 AAs:
0.00021
Total prob of N-in:
0.04688
outside
1  -  205
 
 

Population Genetic Test Statistics

Pi
317.559675
Theta
186.349197
Tajima's D
2.165634
CLR
0.584712
CSRT
0.905254737263137
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号