SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01787
Pre Gene Modal
BGIBMGA006153
Annotation
hypothetical_protein_OBRU01_16796?_partial_[Operophtera_brumata]
Full name
Tubulin glycylase 3A      
Location in the cell
Nuclear   Reliability : 2.617
 

Sequence

CDS
ATGTTAATACACGAAACAAAATTTGATATAAGGCAATATTATTTGATTACCAGTACATATCCTTTGATTATTTGGATATATAAAGACTGTTATTTGAAGTTCAGCTCTCAGAAATATAACCTTGGAAACTACCATGAATCTATACATTTAACTAACAACGCCGTACAAAGGAGATATATGAACTGTGAAGAGCGCCATCCTGATCTACCCAATAACAATATGTGGGATTTGGATACCTATAAAGATTATTTAAAGGCAATCGGCAAACCCTCGGTGTGGGATGATTTAATATATCCCGGTATGAAAAAGACAATCACAGGTGTGATGCTTAGTAGCCAAGAAACAATGCCGGCTTGCAAGAATCGCTTTGAACTGTACGGTTGCGATTTCCTACTGGACAAAGATTACAAGCCTTGGTTAATCGAAATCAATGCATGCCCTGATCTCAACAGTACCACACGAGTCACCGCGAAAATTTGTCCGGCCGTTTTAGCTGATGTCATTAAAGGTTTGATATAA
Protein
MLIHETKFDIRQYYLITSTYPLIIWIYKDCYLKFSSQKYNLGNYHESIHLTNNAVQRRYMNCEERHPDLPNNNMWDLDTYKDYLKAIGKPSVWDDLIYPGMKKTITGVMLSSQETMPACKNRFELYGCDFLLDKDYKPWLIEINACPDLNSTTRVTAKICPAVLADVIKGLI

Summary

Description
Polylycylase which modifies alpha- and beta-tubulin, generating side chains of glycine on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin. Involved both in the side-chain initiation and elongation steps of the polyglycylation reaction by adding a single glycine chain to generate monoglycine side chains and by elongating monoglycine side chains to polyglycine side chains.
Keywords
ATP-binding   Complete proteome   Cytoplasm   Cytoskeleton   Ligase   Microtubule   Nucleotide-binding   Reference proteome  
Feature
chain  Tubulin glycylase 3A
EC Number
6.3.2.-
EMBL
BABH01004776    JTDY01004642    KOB67919.1    ODYU01011578    SOQ57406.1    AGBW02009882    + More
OWR49655.1    KQ460855    KPJ11885.1    KQ459601    KPI93999.1    NWSH01000013    PCG80845.1    BABH01004775    GEZM01058134    JAV71879.1    GEZM01058136    JAV71877.1    PCG80846.1    KPJ11884.1    OWR49656.1    GEBQ01022535    JAT17442.1    AJWK01010432    AJVK01006597    JRES01000973    KNC26660.1    GECU01017186    JAS90520.1    GEZM01058137    JAV71875.1    GECU01010640    JAS97066.1    GEBQ01012035    JAT27942.1    KZ288283    PBC29514.1    GECU01012772    JAS94934.1    CVRI01000047    CRK98567.1    GEBQ01005238    JAT34739.1    GEDC01008582    JAS28716.1    CCAG010016184    QOIP01000010    RLU18082.1    CH940649    EDW63600.1    GEZM01058135    JAV71878.1    GECZ01011081    GECZ01005312    JAS58688.1    JAS64457.1    GECZ01017579    GECZ01004738    JAS52190.1    JAS65031.1    CH933807    EDW11723.1    CM002910    KMY88609.1    KQ435700    KOX80565.1    ATLV01014106    KE524943    KFB38333.1    AE014134    CH480818    EDW51902.1    CH954177    EDV59123.1    CM000157    EDW87845.1    CH902620    EDV31571.1    KQ434822    KZC07100.1    CH916368    EDW02892.1    DS231970    EDS29740.1    CP012523    ALC38434.1    GECZ01001763    JAS68006.1    GEBQ01022614    JAT17363.1    CH379058    EAL34477.2    GL435087    EFN74052.1    KQ971343    KYB27443.1    CH479184    EDW36941.1    LBMM01000547    KMQ98084.1    GECU01020318    JAS87388.1    GBRD01006538    JAG59283.1    KK107167    EZA56223.1    GL446618    EFN87487.1    GBRD01006539    JAG59282.1    OUUW01000010    SPP85706.1    AAAB01008980    EAA13905.3    JXJN01017195    CH477196    EAT48373.1    ADTU01008677    GEBQ01025960    JAT14017.1    CH963920    EDW78060.1    NNAY01000494    OXU28004.1    NIVC01000089    PAA91402.1    AAZX01007838    NIVC01002647    PAA56255.1    GL888177    EGI65851.1    AXCM01001818    ADMH02000503    ETN66181.1    AXCN02001993    JXUM01003334    JXUM01003335    JXUM01003336    JXUM01003337    JXUM01003338    JXUM01003339    JXUM01003340    JXUM01003341    KQ560156    KXJ84138.1    GECZ01019878    JAS49891.1    GECZ01030690    JAS39079.1    NIVC01000019    PAA93940.1    KQ976435    KYM87039.1    APCN01001680   
Pfam
PF03133   TTL        + More
PF15346   ARGLU
PF04193   PQ-loop
PF13499   EF-hand_7
Interpro
IPR033371   ARGLU1        + More
IPR004344   TTL/TTLL_fam       
IPR006603   PQ-loop_rpt       
IPR002048   EF_hand_dom       
IPR011992   EF-hand-dom_pair       
IPR018247   EF_Hand_1_Ca_BS       
IPR013815   ATP_grasp_subdomain_1       
SUPFAM
SSF47473   SSF47473       
Gene 3D
PDB
5VLQ     E-value=1.742e-44,     Score=447

Ontologies

Topology

Subcellular location
  
Length:
172
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
6.49663999999999
Exp number, first 60 AAs:
6.49584
Total prob of N-in:
0.14355
outside
1  -  172
 
 

Population Genetic Test Statistics

Pi
310.206653
Theta
212.03484
Tajima's D
1.45769
CLR
0
CSRT
0.781110944452777
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号