Gene
KWMTBOMO01779
Pre Gene Modal
BGIBMGA006150
Annotation
integrin_beta3_[Bombyx_mori]
Full name
Integrin beta
+ More
Integrin beta pat-3
Integrin beta pat-3
Alternative Name
Paralyzed arrest at two-fold protein 3
Location in the cell
Nuclear Reliability : 4.127
Sequence
CDS
ATGAAACTTCGTATAGGTGAACCACAAAAGTTCAATTTCACCTACGATTTCAAGGACAATCCCGTTGATGTGTATTTCTTGTTGGATGCCTCCGCTATGATGGGAACGAAAATAAAGAATATTGCAAGCAAAGCCGACGGCCTTTACAAAACCCTGGAGACTCTGACGAACGACTTCACTTTAGGAGTGGGTACATTTATAGATAAAAACACGTGGAAGGAGAATGGTAAAGAAAGCTACTCATTCGCTCATGAATTGAGTTTGACAAAAGACCATCAGAAATTCGTTACTGCTTTAGAATCCACACCCACGGGCTACAATCGTGATCCGCCAACTGGATGCTTGGACGCTATAGCCCAGGCTATTGTCTGCGATAAGCTAATTGGATGGCGTGAAAAATCTAGAAAGATCATAGTCGTTCTAACCAACAACAATTACCATGACGCCGGCGACGGAAGACTATCCGGTATATTTGAGCCATATGACGGACAGTGTTACACGGATTTAAAGAACAAAAGATATAAGAGAGAATTGACAATGGATTACCCTAGCGTTGGCATGATTAATAAACTTGTCGATCATTACAAAGTGACAGTACTGTTTCTAGTTGAATCAACTGTGAAATCAGCTTACCAGAGTTTGTCAGATGTGATATCTGGTTCGTACATAGACGACTGGGTCAATGAACCGATTAATCCATACGACACTACAGGTCAAACTTTAAAGAAAATATACAAGCAAATCATTGGAAACGTCACGCTGAACGTGGATTTTAAAGCGAAAAATATTGAAAACGTGAAGATACACTTAAGTCCTAACTGCACTAAAGGAAACTACGATAAGAACTGCCTGGTCAAAACAGATCAATCTATAAAATTTGAAGGGTCAGTCGAGATTCTTAACTACGACAGTGCGGACAATGTTTCGGTCGAATTTTCGGTACAAGGACTGGCTGAGAAATTATCAATCGATATTGATGTTATAAGTGATTGTCGGTGCGAAGGAAATGAAAAATCCTCGGGATATTGCAACGGCAGACCTCTTGAGTGCGGACAGTGCTTATGTGACGACGGAAAGTACGTACCTGTTTACTGTAACTAG
Protein
MKLRIGEPQKFNFTYDFKDNPVDVYFLLDASAMMGTKIKNIASKADGLYKTLETLTNDFTLGVGTFIDKNTWKENGKESYSFAHELSLTKDHQKFVTALESTPTGYNRDPPTGCLDAIAQAIVCDKLIGWREKSRKIIVVLTNNNYHDAGDGRLSGIFEPYDGQCYTDLKNKRYKRELTMDYPSVGMINKLVDHYKVTVLFLVESTVKSAYQSLSDVISGSYIDDWVNEPINPYDTTGQTLKKIYKQIIGNVTLNVDFKAKNIENVKIHLSPNCTKGNYDKNCLVKTDQSIKFEGSVEILNYDSADNVSVEFSVQGLAEKLSIDIDVISDCRCEGNEKSSGYCNGRPLECGQCLCDDGKYVPVYCN
Summary
Description
Integrin alpha ina-1/beta pat-3 is a receptor for laminin. Integrin alpha pat-2/beta pat-3 recognizes the sequence R-G-D in its ligands (Probable). Plays a role in cell migration, morphogenesis and probably in cell-cell interactions (PubMed:19023419, PubMed:17326220, PubMed:23283987). During gonad morphogenesis, involved in distal tip cell (DTC)-mediated guidance of gonad elongation, in maintaining their sharp tapering morphology and in their migration (PubMed:19023419). Component of an integrin containing attachment complex, which is required for muscle development and maintenance (PubMed:22253611). Involved in the assembly of dense bodies and M lines during body wall muscle embryonic development by recruiting one of their components, cpna-1, to integrin-mediated attachment sites (PubMed:23283987). May play a similar role in the assembly of dense bodies in gonadal myoepithelial sheath cells (PubMed:17326220). Probably by acting as a receptor for apoptotic cells, plays a role in the clearance of apoptotic cells during mid-embryogenesis (PubMed:20226672). Required for ovulation (PubMed:17326220). Dephosphorylated, probably within the alpha pat-2/beta pat-3 integrin receptor complex, by the phosphatase dep-1, which leads to down-stream effects including the negative regulation of let-23 signaling and vulval induction (PubMed:28135265). When unphosphosphorylated, recruits the cytoplasmic adapter protein tln-1 to the plasma membrane of secondary vulval precursor cells (PubMed:28135265). This promotes the linking of focal adhesion sites to the F-actin cytoskeleton, and it also acts to restrict the mobility of the let-23 receptor on the plasma membrane of vulval cells which thereby attenuates let-23 signaling (PubMed:28135265).
Subunit
Heterodimer of an alpha and a beta subunit (Probable). Interacts with alpha subunit ina-1 (PubMed:9247263). Interacts with alpha subunit pat-2 (Probable). Component of an integrin containing attachment complex, composed of at least pat-2, pat-3, pat-4, pat-6, unc-52, unc-97 and unc-112 (PubMed:22253611).
Similarity
Belongs to the integrin beta chain family.
Keywords
Cell adhesion
Cell junction
Cell membrane
Complete proteome
Cytoplasm
Glycoprotein
Integrin
Membrane
Phosphoprotein
Receptor
Reference proteome
Signal
Transmembrane
Transmembrane helix
Feature
chain Integrin beta
Uniprot
H9J9F7
A0A076JP59
A0A0L7KWE2
A0A2A4IXQ7
A0A2H1V7X1
A0A212FB70
+ More
A0A194PKP6 A0A194R3R5 X2BBX2 X2BBV3 A0A194PMP9 T1JH92 T1K5U0 A0A194R7M9 A0A336MVT2 A0A0P5M3S6 A0A1S3IPR8 A0A1A8Q199 A0A336KRK3 A0A0P5UM69 A0A0P5D6D2 A0A1S3I615 A0A2D3E2V7 A0A1S3JZW7 A0A0P5BN00 Q27874 Q4STQ0 A0A2G5UJ11 A8WVF5 Q66PY4 A0A0P5VHQ5 H3CML1 A0A232F1V4 A0A2P4V5J0 K7IP94 A0A0P5A8H6 A0A2A2L579 G0MBY9 A0A1W0WHB7 A0A2A2L5G1 A0A0P5THI9 A0A0N8E8X0 A0A260Z887 A0A2H2IAS9 E3M8G5 A0A1I7TFS9 A0S6A3 A0A2A2L5G4 A0A0P6D6A7 A0A1A8EE12 A0A0P4ZDY9 A0A1A7ZLM3 A0A1A8V6T1 A0A0N8EH96 A0A1S3I8E3 A0A1A8M2F9 A0A1A8PS46 A0A1A8JUP6 A0A0P5TSL1 A0A1A8BIP8 A0A2A2LJ41 A0A0R3PVA5 A0A0P5CT31 A0A0P5RS37 A0A0P5XYV6 A0A0P5E9V5 A0A0P5C8L8 A0A0P6GEF4 A0A0P5N224 A0A0P6BHC8 A0A212FB66 A0A183BHL6 A0A0G3BIA0 A0A0P5AY29 D6WK71 E0VEZ0 A0A1A8IZ67 A0A0P5AE83 A0A0P5ABM7 A0A0P5ZUY6 A0A1A8F1D7 A0A1A8HFL5 A0A0N4XCG4 A0A0K0ELJ0 A0A2A4IWA0 A0A0T6BB89 A0A1V9Y1F5 A0A2I9LP51 A0A3B5MS04 A0A0T6AU97 A0A210Q5V9 A0A146XNB6 A0A0P5LHY9 M3ZSR0 A0A0L0BR65 T1EIY7 A0A090L9L6 A0A0N5BHX4 V5G6J5 A0A2A6CQG3
A0A194PKP6 A0A194R3R5 X2BBX2 X2BBV3 A0A194PMP9 T1JH92 T1K5U0 A0A194R7M9 A0A336MVT2 A0A0P5M3S6 A0A1S3IPR8 A0A1A8Q199 A0A336KRK3 A0A0P5UM69 A0A0P5D6D2 A0A1S3I615 A0A2D3E2V7 A0A1S3JZW7 A0A0P5BN00 Q27874 Q4STQ0 A0A2G5UJ11 A8WVF5 Q66PY4 A0A0P5VHQ5 H3CML1 A0A232F1V4 A0A2P4V5J0 K7IP94 A0A0P5A8H6 A0A2A2L579 G0MBY9 A0A1W0WHB7 A0A2A2L5G1 A0A0P5THI9 A0A0N8E8X0 A0A260Z887 A0A2H2IAS9 E3M8G5 A0A1I7TFS9 A0S6A3 A0A2A2L5G4 A0A0P6D6A7 A0A1A8EE12 A0A0P4ZDY9 A0A1A7ZLM3 A0A1A8V6T1 A0A0N8EH96 A0A1S3I8E3 A0A1A8M2F9 A0A1A8PS46 A0A1A8JUP6 A0A0P5TSL1 A0A1A8BIP8 A0A2A2LJ41 A0A0R3PVA5 A0A0P5CT31 A0A0P5RS37 A0A0P5XYV6 A0A0P5E9V5 A0A0P5C8L8 A0A0P6GEF4 A0A0P5N224 A0A0P6BHC8 A0A212FB66 A0A183BHL6 A0A0G3BIA0 A0A0P5AY29 D6WK71 E0VEZ0 A0A1A8IZ67 A0A0P5AE83 A0A0P5ABM7 A0A0P5ZUY6 A0A1A8F1D7 A0A1A8HFL5 A0A0N4XCG4 A0A0K0ELJ0 A0A2A4IWA0 A0A0T6BB89 A0A1V9Y1F5 A0A2I9LP51 A0A3B5MS04 A0A0T6AU97 A0A210Q5V9 A0A146XNB6 A0A0P5LHY9 M3ZSR0 A0A0L0BR65 T1EIY7 A0A090L9L6 A0A0N5BHX4 V5G6J5 A0A2A6CQG3
Pubmed
19121390
25064490
26227816
22118469
26354079
23254933
+ More
7744961 9851916 9247263 12754521 15888633 17326220 17761667 19023419 20385102 20226672 22253611 22479198 23283987 28135265 15496914 14624247 15804572 28648823 26114425 26394399 20075255 26004499 18362917 19820115 20566863 28327890 29248469 28812685 23542700 26108605 18806794
7744961 9851916 9247263 12754521 15888633 17326220 17761667 19023419 20385102 20226672 22253611 22479198 23283987 28135265 15496914 14624247 15804572 28648823 26114425 26394399 20075255 26004499 18362917 19820115 20566863 28327890 29248469 28812685 23542700 26108605 18806794
EMBL
BABH01004744
BABH01004745
BABH01004746
BABH01004747
KJ511856
AII79415.1
+ More
JTDY01005041 KOB67435.1 NWSH01005801 PCG63940.1 ODYU01001118 SOQ36886.1 AGBW02009374 OWR50969.1 KQ459601 KPI94006.1 KQ460855 KPJ11880.1 AMQN01000124 KPI94009.1 JH432223 CAEY01001590 KPJ11876.1 UFQS01003187 UFQT01003187 SSX15340.1 SSX34714.1 GDIQ01164713 JAK87012.1 HAEI01004022 SBR86974.1 UFQS01000673 UFQT01000673 SSX06025.1 SSX26382.1 GDIP01111036 JAL92678.1 GDIP01164831 JAJ58571.1 MF140473 ATU31738.1 GDIP01182525 JAJ40877.1 U19744 BX284603 CAAE01014125 CAF95982.1 PDUG01000003 PIC39542.1 HE601339 CAP24466.2 AY630342 AAU11316.1 GDIP01114843 JAL88871.1 NNAY01001290 OXU24469.1 LFJK02001324 POM32568.1 GDIP01202671 JAJ20731.1 LIAE01007179 PAV81421.1 GL379789 EGT45620.1 MTYJ01000102 OQV14598.1 PAV81420.1 GDIP01126147 JAL77567.1 GDIQ01050308 JAN44429.1 NMWX01000217 OZF81893.1 DS268428 EFO94485.1 DQ289584 ABB92837.1 PAV81419.1 GDIQ01090133 JAN04604.1 HAEA01015386 SBQ43866.1 GDIP01215034 JAJ08368.1 HADY01005129 SBP43614.1 HAEJ01014815 SBS55272.1 GDIQ01026900 JAN67837.1 HAEF01010624 SBR50741.1 HAEH01008195 SBR83832.1 HAEE01003726 SBR23746.1 GDIP01140132 JAL63582.1 HADZ01002439 SBP66380.1 LIAE01006693 PAV86222.1 UYYA01004379 VDM61526.1 GDIP01171530 JAJ51872.1 GDIQ01098191 JAL53535.1 GDIP01078290 LRGB01002793 JAM25425.1 KZS06306.1 GDIP01163022 JAJ60380.1 GDIP01178880 JAJ44522.1 GDIQ01034304 JAN60433.1 GDIQ01170201 JAK81524.1 GDIP01015915 JAM87800.1 OWR50970.1 KP795392 AKJ26284.1 GDIP01192724 JAJ30678.1 KQ971342 EFA03618.2 DS235100 EEB11964.1 HAED01015348 SBR01793.1 GDIP01200122 JAJ23280.1 GDIP01201364 JAJ22038.1 GDIP01038202 JAM65513.1 HAEB01006064 SBQ52591.1 HAEC01014784 SBQ83001.1 UYSL01000037 VDL62417.1 PCG63939.1 LJIG01002322 KRT84618.1 MNPL01000976 OQR79540.1 GFWZ01000163 MBW20153.1 LJIG01022803 KRT78632.1 NEDP02004918 OWF44108.1 GCES01043159 JAR43164.1 GDIQ01169362 JAK82363.1 JRES01001480 KNC22570.1 AMQM01008990 KB095901 ESO10276.1 LN609528 CEF64818.1 GALX01002761 JAB65705.1 ABKE03000023 PDM80454.1
JTDY01005041 KOB67435.1 NWSH01005801 PCG63940.1 ODYU01001118 SOQ36886.1 AGBW02009374 OWR50969.1 KQ459601 KPI94006.1 KQ460855 KPJ11880.1 AMQN01000124 KPI94009.1 JH432223 CAEY01001590 KPJ11876.1 UFQS01003187 UFQT01003187 SSX15340.1 SSX34714.1 GDIQ01164713 JAK87012.1 HAEI01004022 SBR86974.1 UFQS01000673 UFQT01000673 SSX06025.1 SSX26382.1 GDIP01111036 JAL92678.1 GDIP01164831 JAJ58571.1 MF140473 ATU31738.1 GDIP01182525 JAJ40877.1 U19744 BX284603 CAAE01014125 CAF95982.1 PDUG01000003 PIC39542.1 HE601339 CAP24466.2 AY630342 AAU11316.1 GDIP01114843 JAL88871.1 NNAY01001290 OXU24469.1 LFJK02001324 POM32568.1 GDIP01202671 JAJ20731.1 LIAE01007179 PAV81421.1 GL379789 EGT45620.1 MTYJ01000102 OQV14598.1 PAV81420.1 GDIP01126147 JAL77567.1 GDIQ01050308 JAN44429.1 NMWX01000217 OZF81893.1 DS268428 EFO94485.1 DQ289584 ABB92837.1 PAV81419.1 GDIQ01090133 JAN04604.1 HAEA01015386 SBQ43866.1 GDIP01215034 JAJ08368.1 HADY01005129 SBP43614.1 HAEJ01014815 SBS55272.1 GDIQ01026900 JAN67837.1 HAEF01010624 SBR50741.1 HAEH01008195 SBR83832.1 HAEE01003726 SBR23746.1 GDIP01140132 JAL63582.1 HADZ01002439 SBP66380.1 LIAE01006693 PAV86222.1 UYYA01004379 VDM61526.1 GDIP01171530 JAJ51872.1 GDIQ01098191 JAL53535.1 GDIP01078290 LRGB01002793 JAM25425.1 KZS06306.1 GDIP01163022 JAJ60380.1 GDIP01178880 JAJ44522.1 GDIQ01034304 JAN60433.1 GDIQ01170201 JAK81524.1 GDIP01015915 JAM87800.1 OWR50970.1 KP795392 AKJ26284.1 GDIP01192724 JAJ30678.1 KQ971342 EFA03618.2 DS235100 EEB11964.1 HAED01015348 SBR01793.1 GDIP01200122 JAJ23280.1 GDIP01201364 JAJ22038.1 GDIP01038202 JAM65513.1 HAEB01006064 SBQ52591.1 HAEC01014784 SBQ83001.1 UYSL01000037 VDL62417.1 PCG63939.1 LJIG01002322 KRT84618.1 MNPL01000976 OQR79540.1 GFWZ01000163 MBW20153.1 LJIG01022803 KRT78632.1 NEDP02004918 OWF44108.1 GCES01043159 JAR43164.1 GDIQ01169362 JAK82363.1 JRES01001480 KNC22570.1 AMQM01008990 KB095901 ESO10276.1 LN609528 CEF64818.1 GALX01002761 JAB65705.1 ABKE03000023 PDM80454.1
Proteomes
UP000005204
UP000037510
UP000218220
UP000007151
UP000053268
UP000053240
+ More
UP000015104 UP000085678 UP000001940 UP000230233 UP000008549 UP000007303 UP000215335 UP000237256 UP000002358 UP000218231 UP000008068 UP000216624 UP000005237 UP000008281 UP000095282 UP000050601 UP000267027 UP000076858 UP000050741 UP000007266 UP000009046 UP000038043 UP000271162 UP000035681 UP000192247 UP000261380 UP000242188 UP000002852 UP000037069 UP000015101 UP000035682 UP000046392 UP000232936
UP000015104 UP000085678 UP000001940 UP000230233 UP000008549 UP000007303 UP000215335 UP000237256 UP000002358 UP000218231 UP000008068 UP000216624 UP000005237 UP000008281 UP000095282 UP000050601 UP000267027 UP000076858 UP000050741 UP000007266 UP000009046 UP000038043 UP000271162 UP000035681 UP000192247 UP000261380 UP000242188 UP000002852 UP000037069 UP000015101 UP000035682 UP000046392 UP000232936
Pfam
Interpro
IPR015812
Integrin_bsu
+ More
IPR036465 vWFA_dom_sf
IPR002035 VWF_A
IPR002369 Integrin_bsu_VWA
IPR013111 EGF_extracell
IPR014836 Integrin_bsu_cyt_dom
IPR040622 I-EGF_1
IPR012896 Integrin_bsu_tail
IPR036349 Integrin_bsu_tail_dom_sf
IPR032695 Integrin_dom_sf
IPR033760 Integrin_beta_N
IPR016201 PSI
IPR015439 Integrin_bsu-2
IPR037076 Integrin_bsu_cyt_dom_sf
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR036465 vWFA_dom_sf
IPR002035 VWF_A
IPR002369 Integrin_bsu_VWA
IPR013111 EGF_extracell
IPR014836 Integrin_bsu_cyt_dom
IPR040622 I-EGF_1
IPR012896 Integrin_bsu_tail
IPR036349 Integrin_bsu_tail_dom_sf
IPR032695 Integrin_dom_sf
IPR033760 Integrin_beta_N
IPR016201 PSI
IPR015439 Integrin_bsu-2
IPR037076 Integrin_bsu_cyt_dom_sf
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
Gene 3D
ProteinModelPortal
H9J9F7
A0A076JP59
A0A0L7KWE2
A0A2A4IXQ7
A0A2H1V7X1
A0A212FB70
+ More
A0A194PKP6 A0A194R3R5 X2BBX2 X2BBV3 A0A194PMP9 T1JH92 T1K5U0 A0A194R7M9 A0A336MVT2 A0A0P5M3S6 A0A1S3IPR8 A0A1A8Q199 A0A336KRK3 A0A0P5UM69 A0A0P5D6D2 A0A1S3I615 A0A2D3E2V7 A0A1S3JZW7 A0A0P5BN00 Q27874 Q4STQ0 A0A2G5UJ11 A8WVF5 Q66PY4 A0A0P5VHQ5 H3CML1 A0A232F1V4 A0A2P4V5J0 K7IP94 A0A0P5A8H6 A0A2A2L579 G0MBY9 A0A1W0WHB7 A0A2A2L5G1 A0A0P5THI9 A0A0N8E8X0 A0A260Z887 A0A2H2IAS9 E3M8G5 A0A1I7TFS9 A0S6A3 A0A2A2L5G4 A0A0P6D6A7 A0A1A8EE12 A0A0P4ZDY9 A0A1A7ZLM3 A0A1A8V6T1 A0A0N8EH96 A0A1S3I8E3 A0A1A8M2F9 A0A1A8PS46 A0A1A8JUP6 A0A0P5TSL1 A0A1A8BIP8 A0A2A2LJ41 A0A0R3PVA5 A0A0P5CT31 A0A0P5RS37 A0A0P5XYV6 A0A0P5E9V5 A0A0P5C8L8 A0A0P6GEF4 A0A0P5N224 A0A0P6BHC8 A0A212FB66 A0A183BHL6 A0A0G3BIA0 A0A0P5AY29 D6WK71 E0VEZ0 A0A1A8IZ67 A0A0P5AE83 A0A0P5ABM7 A0A0P5ZUY6 A0A1A8F1D7 A0A1A8HFL5 A0A0N4XCG4 A0A0K0ELJ0 A0A2A4IWA0 A0A0T6BB89 A0A1V9Y1F5 A0A2I9LP51 A0A3B5MS04 A0A0T6AU97 A0A210Q5V9 A0A146XNB6 A0A0P5LHY9 M3ZSR0 A0A0L0BR65 T1EIY7 A0A090L9L6 A0A0N5BHX4 V5G6J5 A0A2A6CQG3
A0A194PKP6 A0A194R3R5 X2BBX2 X2BBV3 A0A194PMP9 T1JH92 T1K5U0 A0A194R7M9 A0A336MVT2 A0A0P5M3S6 A0A1S3IPR8 A0A1A8Q199 A0A336KRK3 A0A0P5UM69 A0A0P5D6D2 A0A1S3I615 A0A2D3E2V7 A0A1S3JZW7 A0A0P5BN00 Q27874 Q4STQ0 A0A2G5UJ11 A8WVF5 Q66PY4 A0A0P5VHQ5 H3CML1 A0A232F1V4 A0A2P4V5J0 K7IP94 A0A0P5A8H6 A0A2A2L579 G0MBY9 A0A1W0WHB7 A0A2A2L5G1 A0A0P5THI9 A0A0N8E8X0 A0A260Z887 A0A2H2IAS9 E3M8G5 A0A1I7TFS9 A0S6A3 A0A2A2L5G4 A0A0P6D6A7 A0A1A8EE12 A0A0P4ZDY9 A0A1A7ZLM3 A0A1A8V6T1 A0A0N8EH96 A0A1S3I8E3 A0A1A8M2F9 A0A1A8PS46 A0A1A8JUP6 A0A0P5TSL1 A0A1A8BIP8 A0A2A2LJ41 A0A0R3PVA5 A0A0P5CT31 A0A0P5RS37 A0A0P5XYV6 A0A0P5E9V5 A0A0P5C8L8 A0A0P6GEF4 A0A0P5N224 A0A0P6BHC8 A0A212FB66 A0A183BHL6 A0A0G3BIA0 A0A0P5AY29 D6WK71 E0VEZ0 A0A1A8IZ67 A0A0P5AE83 A0A0P5ABM7 A0A0P5ZUY6 A0A1A8F1D7 A0A1A8HFL5 A0A0N4XCG4 A0A0K0ELJ0 A0A2A4IWA0 A0A0T6BB89 A0A1V9Y1F5 A0A2I9LP51 A0A3B5MS04 A0A0T6AU97 A0A210Q5V9 A0A146XNB6 A0A0P5LHY9 M3ZSR0 A0A0L0BR65 T1EIY7 A0A090L9L6 A0A0N5BHX4 V5G6J5 A0A2A6CQG3
PDB
3V4V
E-value=5.71915e-39,
Score=404
Ontologies
GO
GO:0016021
GO:0007155
GO:0007229
GO:0007160
GO:0038023
GO:0008305
GO:0046716
GO:0055002
GO:0045987
GO:0072327
GO:0009925
GO:0040017
GO:1904901
GO:0040028
GO:0043005
GO:0009986
GO:0060279
GO:0033627
GO:0005604
GO:0007005
GO:0030018
GO:0060298
GO:0016328
GO:0031430
GO:0055001
GO:0016477
GO:1903356
GO:0042059
GO:0055120
GO:1903354
GO:0005925
GO:0032956
GO:0005178
GO:0043025
PANTHER
Topology
Subcellular location
Membrane
Cell membrane In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Lateral cell membrane In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Basal cell membrane In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Cytoplasm In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Myofibril In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Sarcomere In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
M line In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Cell junction In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Focal adhesion In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Cell membrane In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Lateral cell membrane In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Basal cell membrane In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Cytoplasm In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Myofibril In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Sarcomere In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
M line In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Cell junction In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Focal adhesion In body wall muscle cells localizes to the base of thick filament M-lines, dense bodies (Z-disks) and in adhesion plaques which form between adjacent cells (PubMed:22479198, PubMed:20385102). In body wall muscles, colocalizes with cpna-1 at integrin adhesion structures (M line and dense bodies) (PubMed:23283987). Deacreased localization to dense bodies during the L2/L3 molt (PubMed:20385102). In myoepithelial sheath cells, colocalizes in dense bodies-like structures with actin thin filaments, deb-1/vinculin and unc-52 (PubMed:17326220). With evidence from 4 publications.
Length:
366
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00552
Exp number, first 60 AAs:
0.00486
Total prob of N-in:
0.01523
outside
1 - 366
Population Genetic Test Statistics
Pi
166.835578
Theta
153.839579
Tajima's D
0.35943
CLR
18.745802
CSRT
0.475176241187941
Interpretation
Uncertain
