SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01702
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.814
 

Sequence

CDS
ATGTATGGTTGCGAAACGTGGACCCTGAAAGAGGACACTACAAGACGCCTACAGGCATTCGAGATGTGGTGCTACCGTCCCATGTTACGCATCAGTTGGACGCAGAGGGTCAGGAACGAAACCGTGCTTCAGCGCGTTCATATGTCCCGGAAAATGCTGCCTGCTATCAAAAAGTGCAAGATAGAGTATCTCGGCCATGTGCTCAGGAACGATCGATACGTGCTGCTGCAGCTGATAATTATGGGCAAAGTGGACGGAAAGAGACGTGCTGGGCGAAGAAAAAAGTCATGGCTCCGGAATATCCGGGAGTGGACCGGTATTGCCTCCGTCGAACAGCTGTTCCGGCTGGCTGCTGACAGAAAGGAATACAGGAAGCTAACGGCCAACCTTCAGGATTGA
Protein
MYGCETWTLKEDTTRRLQAFEMWCYRPMLRISWTQRVRNETVLQRVHMSRKMLPAIKKCKIEYLGHVLRNDRYVLLQLIIMGKVDGKRRAGRRKKSWLRNIREWTGIASVEQLFRLAADRKEYRKLTANLQD

Summary

EMBL
GU815089    ADF18552.1    NWSH01002736    PCG67606.1    KQ977522    KYN02133.1    + More
GDHC01017214    JAQ01415.1    GBHO01041897    JAG01707.1    GBRD01005612    JAG60209.1    GBHO01028834    JAG14770.1    LBMM01003995    KMQ92919.1    GBHO01020011    GDHC01013600    JAG23593.1    JAQ05029.1    NWSH01001998    PCG69477.1    LBMM01001656    KMQ95932.1    ABLF02012409    ABLF02012412    ODYU01000306    SOQ34818.1    GGMR01005851    MBY18470.1    KZ149985    PZC75696.1    GGMS01004979    MBY74182.1    GGMR01013640    MBY26259.1    NWSH01000469    PCG76200.1    GGMS01008711    MBY77914.1    BART01031562    GAH15691.1    GGMS01001437    MBY70640.1    AAGJ04161766    HACG01049494    HACG01049495    CEK96359.1    CEK96360.1    AFYH01119920    GGMR01016881    MBY29500.1    HACG01049490    HACG01049491    CEK96355.1    CEK96356.1    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    GGMR01016842    MBY29461.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    GGMR01018096    MBY30715.1    AHAT01022938    GBHO01034555    JAG09049.1    GGMR01009131    MBY21750.1    AHAT01009145    KK852779    KDR16678.1    NEVH01002574    PNF41923.1    KK853131    KDR10935.1    HACG01049255    CEK96120.1    HACG01049245    CEK96110.1    HACG01049249    CEK96114.1    KK852941    KDR13536.1    GGMS01006790    MBY75993.1    AHAT01017643    NEVH01023958    PNF17737.1    NEVH01011876    PNF31501.1    KK852482    KDR22935.1    KK852811    KDR15914.1    NEVH01010478    PNF32508.1    KF881086    AIJ27485.1    NEVH01009398    PNF33135.1    NEVH01004403    PNF39833.1    GBRD01015972    GBRD01015971    GBRD01015970    JAG49854.1    NEVH01000001    PNF44158.1    KF881087    AIJ27486.1    NEVH01025635    PNF15414.1    NEVH01008300    PNF34184.1    NEVH01023953    PNF17874.1    NEVH01013201    PNF29989.1    NEVH01017534    PNF24114.1    AHAT01012943    NEVH01017535    PNF24084.1    NEVH01020333    PNF21801.1    NEVH01020940    PNF20497.1    NEVH01002157    PNF42414.1    NEVH01009907    PNF32598.1    NEVH01017441    PNF24607.1    MRZV01000221    PIK55282.1    GBHO01033031    GBHO01015473    GBHO01015472    GBHO01015471    GBHO01015469    GBHO01013134    GBHO01013133    GBHO01013129    GBHO01013128    JAG10573.1    JAG28131.1    JAG28132.1    JAG28133.1    JAG28135.1    JAG30470.1    JAG30471.1    JAG30475.1    JAG30476.1    GDHC01007098    GDHC01001590    JAQ11531.1    JAQ17039.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR000637   HMGI/Y_DNA-bd_CS       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
132
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01199
Exp number, first 60 AAs:
0.00021
Total prob of N-in:
0.31045
outside
1  -  132
 
 

Population Genetic Test Statistics

Pi
171.84941
Theta
161.934438
Tajima's D
0.25383
CLR
0
CSRT
0.44202789860507
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号