SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01628
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.299 Nuclear   Reliability : 1.276
 

Sequence

CDS
ATGTTCAATAATAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGATCACACAAGTCTGGGTGGCGGCGCGTGAAATCGACATCATCCGGCATGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGACTACAAGATATGGCAACACTTGGAGAAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCAATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATACAAAATCACGGAGGTCATTTTGAATAA
Protein
MFNNRHWVFQQDSAPAHRAKITQVWVAAREIDIIRHEDWPSSSPDLNPLDYKIWQHLEKKACSKPHPNLESLKTSLIKAAANIDMDLVRAAIDDWPRRLKACIQNHGGHFE

Summary

EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB473770    BAH20555.1    + More
AB363006    AB363010    AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    U47917    AAB47739.1    LNIX01000030    OXA41211.1    UYSL01022144    VDL79905.1    UYSL01002425    VDL65835.1    PDUG01000005    PIC23776.1    PDUG01000006    PIC20538.1    JARK01001601    EYB87313.1    CAVP010058755    CDL95145.1    UYSL01019905    VDL71189.1    UYSL01009772    VDL68385.1    DS268433    EFO97645.1    DS268747    EFP00909.1    UZAH01001595    VDO19836.1    JARK01001658    EYB84158.1    DS268420    EFO87874.1    JF779677    AEO90418.1    UYSL01020634    VDL75527.1    PDUG01000001    PIC51673.1    PIC29926.1    DS268612    EFO94085.1    JOJR01000015    RCN51257.1    DS268492    EFP11689.1    UYSL01021399    VDL78127.1    JOJR01000583    RCN36166.1    UYSL01019770    VDL69590.1    EFP11674.1    DS268565    EFO90304.1    JARK01001337    EYC34439.1    UYSL01023059    VDL81638.1    DS268508    EFO83264.1    DS268606    EFO93488.1    UYSL01019810    VDL70150.1    DS268428    EFO94379.1    JARK01001411    EYC06502.1    DS268673    EFO98001.1    DS268466    EFP06959.1    DS268421    EFO88618.1    DS268539    EFO88027.1    DS268679    EFO98285.1    KI662043    ETN73029.1    PDUG01000012    PIC13506.1    DS268525    EFO85497.1    KN729202    KIH62598.1    JARK01000255    EYC39473.1    UZAH01031030    VDP13493.1    JARK01001471    EYB97976.1    UYSL01020631    VDL75518.1    DS268545    EFO88382.1    HE601413    CAS00486.1    UZAH01026445    VDO80847.1    UYSL01020109    VDL72812.1    UYSL01023743    VDL82626.1    PDUG01000004    PIC32571.1    UYSL01020934    VDL76658.1    KN769991    KIH46151.1    JARK01001418    EYC05389.1    PIC28734.1    KN726559    KIH67820.1    KN728435    KIH63782.1    UYSL01021347    VDL77984.1    JARK01000059    EYC44525.1    KN726483    KIH68032.1    JARK01001345    EYC27589.1    KN727613    KIH65309.1    JARK01000176    EYC41234.1    PIC31069.1    CAVP010059404    CDL95787.1    KN733186    KIH58375.1    KN727674    KIH65166.1    CAVP010058332    CDL94449.1   
Pfam
PF13358   DDE_3        + More
PF00292   PAX
PF10320   7TM_GPCR_Srsx
Interpro
IPR009057   Homeobox-like_sf        + More
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
IPR036388   WH-like_DNA-bd_sf       
IPR036906   ATPase_V1_fsu_sf       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR019424   7TM_GPCR_Srsx       
SUPFAM
SSF46689   SSF46689       
Gene 3D
PDB
5CR4     E-value=2.29216e-09,     Score=142

Ontologies

Topology

Length:
111
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.29137
outside
1  -  111
 
 

Population Genetic Test Statistics

Pi
0.865232
Theta
0.642945
Tajima's D
0.432041
CLR
0
CSRT
0.601869906504675
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号