SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01557
Pre Gene Modal
BGIBMGA009080
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_potassium_voltage-gated_channel_protein_Shaw-like_[Bombyx_mori]
Full name
Potassium voltage-gated channel protein Shaw      
Alternative Name
Shaw2
Location in the cell
Nuclear   Reliability : 2.728
 

Sequence

CDS
ATGGACGCGGAGAATCGCGTCGTGCTGAACGTGGGCGGTATCCGACACGAGACTTACAAGGCGACCCTGAAGAAGATCCCCGCGACGCGGCTGTCCCGGCTGACGGAGGCGCTCGCCAACTACGACCCGGTGCTCAACGAGTATTTCTTCGACCGACACCCAGGGGTCTTCGCGCAAGTCCTCAACTACTACAGGACGGGCAAACTGCACTACCCAACAGACGTTTGCGGTCCACTTTTCGAGGAAGAGCTGGAGTTCTGGGGTCTGGATGCCAACCAGGTGGAGCCGTGTTGTTGGATGACTTACACACAGCACCGTGACACTCAAGAAACCCTGGCCGTCCTGGACCGCCTCGACTTGGACACTGAGAAGCCCACTGACGAGGAGGTCGCCCGTAAGTTCGGGTTCGAAGAAGATTACCTAAAAGGAACCGTTAGCTGGTGGCAACATCTGAAGCCCCAAATGTGGTCGTTATTCGATGAGCCGTACAGTTCAAATGCTGCTAAGATAATCGGTGTTATATCAGTGTTTTTCATTTGTGTATCGATAATATCGTTCTGCCTAAAAACGCATCCAGACATGAGAGTGCCAGTGATCAGAAACTATTCAGTCACGACTGCGAATCAAACGCAGAGCTGGGCGCTGGACAAAGTGCAGACAAACGCCCACATCGCGTTCTTTTACATCGAGTGTGTGTGTAACGCGTGGTTCACATTGGAGATCCTAGTCCGTTTCATATCCTCTCCAAATAAATGTGAATTCGTCAAATCCTCGGTCAACATCATCGACTACATAGCCACAATGAGCTTTTACATCGACCTCATTCTCCAAAAGTACGCCTCTCACGTCGAGAACGCTGATATCCTCGAGTTCTTCTCGATTATCAGGATTATGAGGCTGTTTAAGTTGACAAGACATTCGTCTGGCCTCAAAATCCTCATCCAGACTTTTAGAGCTTCTGCCAAGGAGTTGACACTGCTAGTGTTTTTCTTGGTACTGGGTATTGTGATTTTCGCAAGTCTGGTGTACTACGCGGAGAGGATACAGACGAATCCTCACAATGACTTCAATAGTATACCGCTGGGACTATGGTGGGCCCTAGTGACTATGACTACCGTTGGATATGGTGACATGGCGCCGAAAACCTACGTCGGAATGTTCGTTGGAGCGCTCTGCGCCTTAGCTGGGGTACTGACGATAGCGCTCCCAGTTCCAGTTATAGTATCGAACTTCGCCATGTACTATTCGCACACGCAAGCGAGGGCCAAGCTCCCGAAGAAGCGGCGAAGAGTCATCAATGTGGAACCAACCAGGCCGCCTCTCCGTGCCCCAGGAGTGACCGCCCCAGCTGGACCAATGGCTCCTGGCTTGGGACCTCAAGTCGTCAATCGACGTATGAACGCAATTAAGACCAACCATCCTAAAGATATGATGGGACCTAACATGGATGGTGATCGGTCCCCCATTCATCGCGGATGGAACAAAGTTGCAACTCTAATGCCCGGAATAGATCTCTCAGTTACCACACGATTAACGCCGAGCCCCCGGGACATGTCACCGGCACTGGCCATAGCTCTTCCCATGATGAAATCAGTTAACATCGTCCCAGTCCAGTGCTTCGACAACATGGCCTTCCATAACGACAAAGTCGAGGAGGTCAACAACGAAAATGACAGCAAGTCGTCGAGCAGAGAGGACTCAGTCGATAGCGACAACACCATTCGCGTGAACATCTACAAAAACGAAAACTATTTGGAAAAGATGGAGGATAAATCAGACGCCAGGACTCCGTTGTTACGTGAACACAAGAACGAGTCTCTAGACGAGACTAAATTAAGAACAGAAACGAAAATTGAAAAGAGAAAATCATCGGCATCAACATAA
Protein
MDAENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPTDEEVARKFGFEEDYLKGTVSWWQHLKPQMWSLFDEPYSSNAAKIIGVISVFFICVSIISFCLKTHPDMRVPVIRNYSVTTANQTQSWALDKVQTNAHIAFFYIECVCNAWFTLEILVRFISSPNKCEFVKSSVNIIDYIATMSFYIDLILQKYASHVENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQTNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYVGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVINVEPTRPPLRAPGVTAPAGPMAPGLGPQVVNRRMNAIKTNHPKDMMGPNMDGDRSPIHRGWNKVATLMPGIDLSVTTRLTPSPRDMSPALAIALPMMKSVNIVPVQCFDNMAFHNDKVEEVNNENDSKSSSREDSVDSDNTIRVNIYKNENYLEKMEDKSDARTPLLREHKNESLDETKLRTETKIEKRKSSAST

Summary

Subunit
Heterotetramer of potassium channel proteins.
Miscellaneous
The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
This channel protein belongs to the delayed rectifier class.
Similarity
Belongs to the potassium channel family.
Belongs to the potassium channel family. C (Shaw) (TC 1.A.1.2) subfamily. Shaw sub-subfamily.
Keywords
Complete proteome   Glycoprotein   Ion channel   Ion transport   Membrane   Potassium   Potassium channel   Potassium transport   Reference proteome   Transmembrane   Transmembrane helix   Transport   Voltage-gated channel  
Feature
chain  Potassium voltage-gated channel protein Shaw
EMBL
ODYU01000994    SOQ36589.1    KQ460636    KPJ13361.1    AGBW02009441    OWR50798.1    + More
KQ459562    KPI99757.1    KZ149928    PZC77474.1    AXCN02000817    AXCN02000818    GEZM01038239    JAV81702.1    AAAB01008964    APCN01002460    APCN01002461    KQ971362    EFA08936.1    CH902620    KPU73276.1    EDV31230.2    MF359243    AWK26946.1    AJVK01009762    AJVK01009763    AJVK01009764    AJVK01009765    KPU73274.1    ATLV01012379    KE524786    KFB36682.1    EAA12472.5    KPU73275.1    KPU73277.1    JXJN01011881    CP012523    ALC38868.1    CH963857    EDW76457.2    CM000157    KRJ97229.1    AE014134    ACL82989.1    AY071475    AAF51068.3    AAL49097.1    CH940649    KRF81779.1    KRF81780.1    KRF81782.1    KRF81783.1    KRF81781.1    CM002910    KMY87966.1    KRJ97230.1    CH954177    KQS70065.1    KMY87968.1    ACPB03012579    JRES01001119    KNC25350.1    OUUW01000004    SPP79068.1    AGB92537.1    KQS70063.1    KMY87964.1    CH933807    EDW12589.2    KRG03313.1    KRF98462.1    GFXV01002036    MBW13841.1    SPP79067.1    EDW64668.2    GAMC01010255    JAB96300.1    GGMR01002775    MBY15394.1    CH379060    KRT04171.1    KRT04174.1    KRT04175.1    KRF81778.1    KRG03312.1    KRT04176.1    CH477424    EAT41194.1    KMY87967.1    EAL33743.3    AGB92536.1    CH916372    EDV99172.1    NEVH01001335    PNF43105.1    EDW87582.2    EDV57672.2    CM000361    EDX03661.1    GAMC01010254    JAB96301.1    KQS70064.1    KMY87965.1    KRG03314.1    M32661    GAMC01010253    JAB96302.1    KRT04173.1    CH479180    EDW28956.1    KRT04172.1    UFQS01002101    UFQT01002101    SSX13237.1    SSX32675.1    ATLV01012381    KFB36686.1    EAA12501.4    GANO01000869    JAB59002.1    UFQT01002344    SSX33246.1   
Pfam
PF00520   Ion_trans        + More
PF02214   BTB_2
Interpro
IPR027359   Volt_channel_dom_sf        + More
IPR003131   T1-type_BTB       
IPR005821   Ion_trans_dom       
IPR003974   K_chnl_volt-dep_Kv3       
IPR015572   Shaw_inv       
IPR000210   BTB/POZ_dom       
IPR003968   K_chnl_volt-dep_Kv       
IPR011333   SKP1/BTB/POZ_sf       
IPR028325   VG_K_chnl       
SUPFAM
SSF54695   SSF54695       
Gene 3D
PDB
3KVT     E-value=3.52588e-63,     Score=615

Ontologies

Topology

Subcellular location
Membrane  
Length:
627
Number of predicted TMHs:
5
Exp number of AAs in TMHs:
107.91362
Exp number, first 60 AAs:
0.001
Total prob of N-in:
0.63467
inside
1  -  169
TMhelix
170  -  188
outside
189  -  223
TMhelix
224  -  246
inside
247  -  324
TMhelix
325  -  344
outside
345  -  358
TMhelix
359  -  376
inside
377  -  382
TMhelix
383  -  405
outside
406  -  627
 
 

Population Genetic Test Statistics

Pi
195.499797
Theta
158.860889
Tajima's D
0.744532
CLR
0.223141
CSRT
0.586370681465927
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号