SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01555
Pre Gene Modal
BGIBMGA009078
Annotation
PREDICTED:_potassium_voltage-gated_channel_protein_Shaw-like_[Bombyx_mori]
Location in the cell
PlasmaMembrane   Reliability : 4.251
 

Sequence

CDS
ATGGATGTCGTGGTAGAGCTAACAATAGTTAGACAGTACGTTGATAAAGCAGAGATTTTGGAGTTTATCTCTATCATCAAGATCCTGAGGCTGTTCAAGCTGACCAGACACAGTCCAGGGCTGAAGATCTTGGTGCACACCTTCAAGGCGTCAGCAAAGGAACTGACGCTGTTAGTGTTTTTTCTGGTCCTCGGAATCGTGATCTTCGCGAGCTTGGTGTACTACGCTGAGAAATCGCAGGATAACCCAGAGAACCAGTTTAAATCTATACCCCTCGGTCTTTGGTGGGCGATCGTCACGATGACCACTGTCGGGTATGGAGATATGGCGCCCAAGACTTACCTCGGGATGTTTGTGGGCGCTCTCTGCGCCTTGGCTGGAGTGCTCACTATCGCGCTGCCCGTTCCCGTGATAGTATCCAACTTCTCCATGTTCTACTCCCATACTCAGGCAAGTGGATAG
Protein
MDVVVELTIVRQYVDKAEILEFISIIKILRLFKLTRHSPGLKILVHTFKASAKELTLLVFFLVLGIVIFASLVYYAEKSQDNPENQFKSIPLGLWWAIVTMTTVGYGDMAPKTYLGMFVGALCALAGVLTIALPVPVIVSNFSMFYSHTQASG

Summary

Similarity
Belongs to the potassium channel family.
EMBL
KZ149928    PZC77473.1    KQ459562    KPI99758.1    KQ460636    KPJ13360.1    + More
GGMR01006175    MBY18794.1    GGMS01004721    MBY73924.1    GBHO01017815    JAG25789.1    GBHO01017816    JAG25788.1    LJIG01001161    KRT85779.1    GDIQ01248423    JAK03302.1    GDIQ01205639    JAK46086.1    GDIQ01249975    JAK01750.1    GDIP01232326    JAI91075.1    GDIQ01107418    GDIP01059485    JAL44308.1    JAM44230.1    GDIP01183816    JAJ39586.1    GDIQ01251468    JAK00257.1    GL732533    EFX84931.1    GDIQ01068031    JAN26706.1    GDIQ01089024    JAN05713.1    GDIQ01049952    JAN44785.1    GDIP01094347    JAM09368.1    GDIQ01144903    JAL06823.1    GGMS01004371    MBY73574.1    NEVH01001335    PNF43116.1    GDIP01185110    JAJ38292.1    AJVK01021811    GDIQ01174096    JAK77629.1    GDIQ01112920    GDIP01085480    LRGB01002384    JAL38806.1    JAM18235.1    KZS07935.1    GFXV01005625    MBW17430.1    ABLF02040673    ABLF02040674    ABLF02040675    ABLF02040682    ABLF02040683    ABLF02040686    ABLF02040688    ABLF02040693    GDIP01165885    JAJ57517.1    GDIP01073234    JAM30481.1    GDIQ01048466    JAN46271.1    GECU01004560    JAT03147.1    KK852544    KDR21624.1    GDIQ01139812    JAL11914.1    GDIP01226307    JAI97094.1    GDIP01220166    JAJ03236.1    GDIQ01176393    JAK75332.1    GDIQ01009264    JAN85473.1    GDIQ01048465    JAN46272.1    GL732530    EFX86305.1    GDIP01218581    JAJ04821.1    APCN01002460    GDIP01199931    JAJ23471.1    GDIP01240121    JAI83280.1    GL768069    EFZ12524.1    AAAB01008964    EAA43883.4    GDIP01247494    JAI75907.1    GDIQ01160111    JAK91614.1    GDIQ01161666    JAK90059.1    GDIQ01137465    JAL14261.1    AMQM01010917    KB095994    ESO09179.1    GEZM01035706    GEZM01035705    JAV83119.1    GDIP01204709    JAJ18693.1    KB631741    ERL85707.1    GDIQ01230623    JAK21102.1    GDIQ01031170    JAN63567.1    ATLV01014699    KE524979    KFB39408.1    GBBM01003409    JAC32009.1    GDIP01085727    LRGB01000996    JAM17988.1    KZS14237.1    GDIP01123316    JAL80398.1    GDIP01152337    JAJ71065.1    GDIQ01151868    JAK99857.1    UFQS01000998    UFQT01000998    SSX08358.1    SSX28381.1    MUJZ01057625    OTF72154.1    GDIP01004968    JAM98747.1    GDIQ01032400    JAN62337.1    GDIP01070884    JAM32831.1    GDIQ01093819    JAL57907.1    APGK01040046    APGK01040047    APGK01040048    APGK01040049    APGK01040050    KB740975    ENN76525.1    GDIP01044930    JAM58785.1    GDIP01063003    JAM40712.1    GDIP01072181    JAM31534.1    GDIQ01006671    JAN88066.1    GBBK01001567    JAC22915.1    AXCM01017532    PYGN01000051    PSN56128.1    KK114184    KFM61840.1    PZQS01000004    PVD32493.1    GDIQ01107425    JAL44301.1    CAEY01000116    GFAC01005164    JAT94024.1    NWSH01001233    PCG72021.1    PCG72022.1   
Pfam
PF00520   Ion_trans        + More
PF02214   BTB_2
PF17906   HTH_48
Interpro
IPR003968   K_chnl_volt-dep_Kv        + More
IPR015572   Shaw_inv       
IPR028325   VG_K_chnl       
IPR005821   Ion_trans_dom       
IPR011333   SKP1/BTB/POZ_sf       
IPR027359   Volt_channel_dom_sf       
IPR003974   K_chnl_volt-dep_Kv3       
IPR003131   T1-type_BTB       
IPR000210   BTB/POZ_dom       
IPR041426   Mos1_HTH       
SUPFAM
SSF54695   SSF54695       
Gene 3D
PDB
6EBM     E-value=4.32885e-35,     Score=365

Ontologies

Topology

Length:
153
Number of predicted TMHs:
3
Exp number of AAs in TMHs:
62.61368
Exp number, first 60 AAs:
5.64378
Total prob of N-in:
0.57234
outside
1  -  54
TMhelix
55  -  77
inside
78  -  89
TMhelix
90  -  107
outside
108  -  116
TMhelix
117  -  139
inside
140  -  153
 
 

Population Genetic Test Statistics

Pi
292.773916
Theta
177.901259
Tajima's D
2.538861
CLR
0.244626
CSRT
0.949952502374881
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号