SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01553
Pre Gene Modal
BGIBMGA009080
Annotation
PREDICTED:_potassium_voltage-gated_channel_protein_Shaw-like_[Plutella_xylostella]
Location in the cell
PlasmaMembrane   Reliability : 4.715
 

Sequence

CDS
ATGGACTTTCTCTTGAGCATTTATGAACGAATTCATAATAGATACGAGACTTACAAGGCGACCTTGAAGAAGATCCCCGCGACGCGACTGTCCCGGCTGACGGAGGCGCTCGCCAACTACGACCCGGTGCTCAACGAGTATTTCTTCGACCGGCACCCAGGGGTCTTTGCCCAAGTCCTCAACTACTACAGAACGGGAAAGCTACATTATCCTACGAATGTGTGCGGTCCACTCTTTGAAGAGGAGCTGGAGTTCTGGGGGCTGGACTCCAACCAGGTGGAGCCATGCTGCTGGTCTACTTACAGCATACACAGGGACACGCAAGTAAGTCCTCGTGTCGTGGTTTTATTTACTATACACACGCAAACAGGATCACGTGTCGTTTTGCGTTGGTAG
Protein
MDFLLSIYERIHNRYETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQVLNYYRTGKLHYPTNVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQVSPRVVVLFTIHTQTGSRVVLRW

Summary

Similarity
Belongs to the potassium channel family.
EMBL
AXCM01016303    ADMH02001711    ETN61339.1    AJVK01009752    KK114184    KFM61839.1    + More
JH431896    NEVH01001335    PNF43116.1    KQ971362    EFA08935.1    GFXV01005625    MBW17430.1    KK852544    KDR21624.1    ABLF02040673    ABLF02040674    ABLF02040675    ABLF02040682    ABLF02040683    ABLF02040686    ABLF02040688    ABLF02040693    KB202047    ESO92677.1    GAKP01022897    JAC36057.1    GEZM01035706    GEZM01035705    JAV83119.1    MWRG01007515    PRD28222.1    GAMC01004476    JAC02080.1    APCN01002460    ATLV01014699    KE524979    KFB39408.1    AMQM01005141    AMQM01005142    KB096830    ESO01058.1    CVRI01000014    CRK89787.1    AAAB01008964    KZ429578    PIS86208.1    AXCN02000817    KQ419930    KOF81934.1    LBMM01005697    KMQ91286.1    CH933807    EDW12404.2    PZQS01000004    PVD32494.1    JXLN01013212    KPM09169.1    CH379058    EDY69652.2    CH902624    EDV33004.2    CM000157    EDW88632.2    KU681444    AOR07224.1    CM002910    KMY89248.1    KU681455    AOR07236.1    CH916372    EDV98944.1    JXUM01083298    KQ563367    KXJ73970.1    CP012525    ALC44463.1    KRG03236.1    MTYJ01000001    OQV25870.1    CH940654    EDW57950.2    JRES01000864    KNC27689.1    JXJN01009667    KPU74245.1    AB212763    BAE75955.1    AE014134    ABV53658.2    CH963920    EDW78078.2    KRT03384.1    KRT03385.1    AAF52768.4    KRJ97950.1    KPU74244.1    KRJ97951.1    UZAL01033156    VDP62733.1    KMY89249.1    CH954177    KQS70372.1    KQS70373.1    EDV58353.2    CCAG010008497    KMY89250.1    KRT03386.1    KRJ97949.1    MUJZ01053887    OTF72954.1    AJVK01009762    AJVK01009763    AJVK01009764    AJVK01009765    GACK01000192    JAA64842.1    KV906658    OON14423.1    GEDC01014043    JAS23255.1    GGMS01002609    MBY71812.1    GL732533    EFX84931.1    APGK01040038    APGK01040039    APGK01040040    KB740975    ENN76524.1    EAA12472.5    GEDV01012426    JAP76131.1    ABJB010403212    DS969391    EEC19938.1    GEDV01009948    JAP78609.1    AXCN02000818    CAQQ02032997    GEFH01001273    JAP67308.1    PNF43105.1    ATLV01012379    KE524786    KFB36682.1    KU681456    AOR07237.1    LJIJ01000397    ODM97910.1   
Pfam
PF00520   Ion_trans        + More
PF02214   BTB_2
PF17906   HTH_48
Interpro
IPR005821   Ion_trans_dom        + More
IPR027359   Volt_channel_dom_sf       
IPR003131   T1-type_BTB       
IPR000210   BTB/POZ_dom       
IPR015572   Shaw_inv       
IPR011333   SKP1/BTB/POZ_sf       
IPR028325   VG_K_chnl       
IPR003974   K_chnl_volt-dep_Kv3       
IPR003968   K_chnl_volt-dep_Kv       
IPR041426   Mos1_HTH       
SUPFAM
SSF54695   SSF54695       
Gene 3D
PDB
3KVT     E-value=2.68822e-49,     Score=486

Ontologies

Topology

Length:
131
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01001
Exp number, first 60 AAs:
0.00027
Total prob of N-in:
0.07607
outside
1  -  131
 
 

Population Genetic Test Statistics

Pi
235.993218
Theta
158.257753
Tajima's D
1.702054
CLR
0.098135
CSRT
0.829758512074396
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号