SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01404
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.703
 

Sequence

CDS
ATGTGCTTTGTAGATTATCAGAAGGCCTTTGATTGCGTGAAATGGGAGAAACTGTGGGAGATCCTAAGTGAAACAGGAGTTCCGAGTCATCTTGTTATGTTGATTCGCAACCTGTACGAGTCGGGATTTGGGTCTATCTCTATCGAAAATGCCACTTCAGGTAAATTTCGTTTCCAAAAAGGAGTCCGGCAAGGATGTGTTATCTCACCTATTCTCTTCAATATATATGGGGAATATATAATGCGCCAGACTTTAGAAAACTGGGAAGGAGGCGTTAGAATAGGGGGGGTTCAGATAACGAACCTGAGATATGCCGATGACACCACACTTCTTGCTTCATCTGAGGCGGAGATGAAGGAGCTTCTGGACAGATTAGAGGCTATAAGCCTAAACATGGGACTAGCAATTAACAAAAGCAAGACCAAGCTGCTAGTCGTAGACCGCTTCTCATCCACTCAGCGTACGGACCTTTTGGCAGAATACGAGGCCGTGGACCAGTTTGTCTACCTTGTTTCTGTGATCACGGATAAGGGGAGCTGTGAGCCTGAAATACGCCGACGAATTGGAATGGCTAAAACAGCTATGACGCAGTTGAGCAAAGTTTGGAAAGATCGTAATATTTCGAATAGGACCAAAATACATATTGTGCACTCACTGGTCTTTCCAATCGCTCTCTATGGAGCAGAAACATGGACCATAAAAGCAGCTGACCGAAACAGAGTTGATGCTTTTGAAATGTGGTGCTGGCGCCGCCTATTAAGGATTCCATGGACAGCCCACCGCACGAACATCTCGGTCCTACATCAGCTTAAAATGGAGAACGCTCAACGCCTGTCTGCCATCTGTCTGCAACGCATAATGCGCTACTTTGGCCACGTTGCCCGCAGAGGTGTAGACAACTTGGAACGTCTGGTGGTCACTGGGAAAGTAGAAGGAAAACGTCCTAGAGGCCGGAGCCCCAAACATTGGTCCGACCAGATCTCCGAGCAAACCAGCGGACCACTTAGCGCTGCACTACACCTGGCAACTGACCGGAACCGATGGAGGCTGACAGTAGACAAGTTAAAACGGAGTCACGATCTTCAGCAATGA
Protein
MCFVDYQKAFDCVKWEKLWEILSETGVPSHLVMLIRNLYESGFGSISIENATSGKFRFQKGVRQGCVISPILFNIYGEYIMRQTLENWEGGVRIGGVQITNLRYADDTTLLASSEAEMKELLDRLEAISLNMGLAINKSKTKLLVVDRFSSTQRTDLLAEYEAVDQFVYLVSVITDKGSCEPEIRRRIGMAKTAMTQLSKVWKDRNISNRTKIHIVHSLVFPIALYGAETWTIKAADRNRVDAFEMWCWRRLLRIPWTAHRTNISVLHQLKMENAQRLSAICLQRIMRYFGHVARRGVDNLERLVVTGKVEGKRPRGRSPKHWSDQISEQTSGPLSAALHLATDRNRWRLTVDKLKRSHDLQQ

Summary

EMBL
FJ265548    ADI61816.1    FJ265557    ADI61825.1    FJ265546    ADI61814.1    + More
FJ265553    ADI61821.1    FJ265547    ADI61815.1    FJ265552    ADI61820.1    FJ265560    ADI61828.1    GU815090    ADF18553.1    KZ150203    PZC72267.1    AHAT01022938    BDSA01000081    GBE63537.1    MRZV01002322    PIK33998.1    ODYU01004401    SOQ44236.1    AFYH01119920    NWSH01002736    PCG67606.1    AAGJ04055194    LK055282    CDR71995.1    GU815089    ADF18552.1    AMGL01091659    AMGL01091660    AMGL01091661    AMGL01091662    AMGL01091663    AMGL01091664    AMGL01091665    AMGL01091666    AMGL01091667    AMGL01091668    GBBM01006298    JAC29120.1    AAGJ04075245    GGMS01004979    MBY74182.1    AJ132772    CAA10770.1    AHAT01022314    AHAT01008485    MRZV01000196    PIK55924.1    AHAT01017643    MRZV01001207    PIK39730.1    LBMM01003995    KMQ92919.1    GBHO01028834    JAG14770.1    AAGJ04093867    GGMS01006790    MBY75993.1    NWSH01001998    PCG69477.1    NEVH01010478    PNF32508.1    LBMM01001656    KMQ95932.1    AHAT01013219    NEVH01002141    PNF42600.1    NEVH01013563    PNF28562.1    NEVH01001347    PNF42965.1    NEVH01015827    PNF26505.1    NEVH01024527    PNF17048.1    NEVH01024955    PNF16252.1    AAGJ04122993    NEVH01027104    PNF13657.1    NEVH01017443    PNF24479.1    NEVH01005885    PNF38476.1    NEVH01025174    PNF15486.1    NEVH01022644    PNF18361.1    NEVH01000251    PNF43864.1    NEVH01012082    PNF30956.1    NEVH01017562    PNF23821.1    NEVH01006832    PNF36369.1    NEVH01013550    PNF28814.1    NEVH01024426    PNF17169.1    NEVH01017534    PNF24114.1    PNF24119.1    NEVH01002704    PNF41497.1    NEVH01021956    PNF18969.1    NEVH01027118    PNF13626.1    NEVH01020867    PNF20816.1    NEVH01011193    PNF31991.1    NEVH01008232    PNF34368.1    NEVH01026089    PNF14819.1    NEVH01001338    PNF43058.1    NEVH01002690    PNF41636.1    NEVH01006732    PNF36770.1    NEVH01006565    PNF37921.1    NEVH01003502    PNF40578.1    NEVH01025130    PNF15928.1    NEVH01002692    PNF41604.1    NEVH01009084    PNF33722.1    NEVH01021197    PNF19999.1    NEVH01021229    PNF19699.1    NEVH01003515    PNF40438.1    NEVH01020341    PNF21589.1    NEVH01021193    PNF20060.1    NEVH01024421    PNF17406.1    NEVH01008283    PNF34242.1    NEVH01011876    PNF31534.1    NEVH01011192    PNF32037.1    NEVH01015882    PNF26389.1    NEVH01021216    NEVH01021205    NEVH01018378    NEVH01016294    NEVH01013243    NEVH01011194    NEVH01011186    PNF19803.1    PNF19913.1    PNF23519.1    PNF26082.1    PNF29477.1    PNF31895.1    PNF32189.1    NEVH01007823    PNF35207.1    NEVH01005906    PNF38146.1    NEVH01015905    PNF26381.1    NEVH01021939    PNF19136.1    NEVH01020856    PNF21060.1    NEVH01011198    PNF31808.1    NEVH01003505    PNF40530.1    NEVH01014359    PNF27807.1    NEVH01024544    PNF16826.1    NEVH01018373    PNF23643.1    NEVH01012083    PNF30919.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
SUPFAM
SSF56219   SSF56219       
Gene 3D
PDB
5IRG     E-value=0.00379477,     Score=95

Ontologies

Topology

Length:
363
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.773859999999999
Exp number, first 60 AAs:
0.0045
Total prob of N-in:
0.04843
outside
1  -  363
 
 

Population Genetic Test Statistics

Pi
64.243992
Theta
68.172063
Tajima's D
-0.603374
CLR
0
CSRT
0.223638818059097
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号