SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01377
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.371
 

Sequence

CDS
ATGTATGGCAGCGAAACATGGGCAGCAACCAAAAGGAACGTACATACCATTCAAGTTGCTGAAATGAAAATGCTGAGGTGGATGTGCGGCGTGACTAGGCTCGATAAAATCCGCAACGAGTACGTGCGTGGAAGTCTAGGTGTACGGGACATCGCCGACAAGATGCAGGAGAGTAGGCTGAGATGGTATGGTCACGTGAAAAGGAAGCCACCTGACTACGTCGGAAATTTGGCGCTACTGCTCGACCTCCCCGGTCGGAGACCTAGAGGCAGACCCAAGACAAGGTGGAGGGACGTAGTGCTGAAGGACAAGAGAGAATGCAATGTTGCTGACGAGAATGTCGAAGACAGAGCGAAGTGGAGGAGTAAAGTCAGGAAAGCTGACCCCACCACCATGTGGGATAAATAG
Protein
MYGSETWAATKRNVHTIQVAEMKMLRWMCGVTRLDKIRNEYVRGSLGVRDIADKMQESRLRWYGHVKRKPPDYVGNLALLLDLPGRRPRGRPKTRWRDVVLKDKRECNVADENVEDRAKWRSKVRKADPTTMWDK

Summary

EMBL
FJ265554    ADI61822.1    CU462842    CBA11992.1    UZAH01027842    VDO95476.1    + More
AMGM01000184    EKB47241.1    UZAH01029822    VDP08057.1    HE805490    CCH50976.1    KZ451907    PKA63681.1    JARK01001415    EYC05905.1    JARK01001430    EYC03360.1    UZAF01001415    UZAF01017114    VDO08263.1    VDO38063.1    KZ452013    PKA51585.1    EYC03359.1    KZ453539    PKA47214.1    KZ452012    PKA51786.1    JARK01001422    EYC04723.1    HQ445899    AEJ72569.1    JARK01000539    EYC36061.1    KZ348915    PIO65553.1    JARK01001428    EYC03715.1    JARK01001472    EYB97834.1    JARK01001340    EYC31495.1    JARK01000281    EYC39011.1    PKA51430.1    KZ451888    PKA66013.1    KZ451885    PKA66495.1    KZ453102    PKA47709.1    JARK01001341    EYC30277.1    UZAH01036764    VDP46995.1    KZ452023    PKA50536.1    KZ350014    PIO64310.1    UZAH01032701    VDP23368.1    PKA51832.1    JARK01001350    EYC24439.1    JARK01001375    EYC14890.1    UZAH01026905    VDO86609.1    UZAH01027034    VDO87933.1    EYC24438.1    UZAH01033088    VDP26174.1    UZAH01030549    VDP10928.1    CAVP010057772    CDL94282.1    UZAH01000951    VDO19393.1    UZAH01000306    VDO18824.1    JARK01001702    EYB82127.1    UZAH01030698    VDP11665.1    UZAH01000694    VDO19186.1    JARK01001582    EYB88469.1    CAVP010062000    CDL96883.1    EYC31496.1    JARK01001356    EYC21107.1    JARK01001722    JARK01001346    EYB81349.1    EYC26203.1    UZAH01009099    VDO35114.1    CAVP010059598    CDL95931.1    UZAH01030983    VDP13266.1    CM009753    PUZ55583.1    JARK01001437    EYC02250.1    JARK01001564    EYB89718.1    UZAH01030101    VDP09262.1    JARK01001592    EYB87852.1   
Pfam
PF00078   RVT_1        + More
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR027124   Swc5/CFDP2       
IPR005135   Endo/exonuclease/phosphatase       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
135
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00189
Exp number, first 60 AAs:
0.00154
Total prob of N-in:
0.29253
outside
1  -  135
 
 

Population Genetic Test Statistics

Pi
243.572614
Theta
192.895349
Tajima's D
0.815471
CLR
0
CSRT
0.604319784010799
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号