SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01316
Annotation
PREDICTED:_uncharacterized_protein_LOC105389086_[Plutella_xylostella]
Location in the cell
Cytoplasmic   Reliability : 1.836 Extracellular   Reliability : 1.562
 

Sequence

CDS
ATGCTGATGAGGATAGCCAAAGTGGTTGACACTGACCTCAGAGAAGAACAGGCAGGGTTTAGACCAGGACGTTTATGCTCGGACCAAATAAACCTTTTACGAATGATCCTAGAACAATGTCAGGAGATGCAGTGTGAAGTTTTCACATTGTTTATCGACTTCGAAAAGGCCTTTGACAGTGTCAGTTGGTCCAGCATTTGGACTGTTTTGAAGAAAAAAGGCGTGCCCGACAAGTTCATAAATGTCATAAAAGCGCTTGACTATGGATCGTCGTGTAGAATGCTCCACAGGGGAAAACTCACGGATAGTATCGTGGTCACCGCAGGCGTCAAGCAAGGTTGCTTGCTGTCTCCCCTGCTGTTTATAGTGGTGCTTGATGATGTGATGCGCAGAGTCACCTGTAAATGCCGACAAGGGCTACCTTGGACCGCGGATGAAGACCTAGAGGACATCGACTTTGCTGATGACATTTGCCTCCTAGCAACCAATCGGCAGCTACAAAACAAAGCAGATGATCTAGTAGATGAAGCTGAAAAGTACTTAAGGGTCAACAAGCTCTCGGCCTTGGCTTTAAGTCCACTACTACTTCTATTCGCCATTCATCTTGAGACCTAA
Protein
MLMRIAKVVDTDLREEQAGFRPGRLCSDQINLLRMILEQCQEMQCEVFTLFIDFEKAFDSVSWSSIWTVLKKKGVPDKFINVIKALDYGSSCRMLHRGKLTDSIVVTAGVKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWTADEDLEDIDFADDICLLATNRQLQNKADDLVDEAEKYLRVNKLSALALSPLLLLFAIHLET

Summary

EMBL
FJ265558    ADI61826.1    GECZ01000686    JAS69083.1    UZAI01018653    VDP39052.1    + More
UZAI01002802    VDO74779.1    UZAI01012291    VDP09918.1    UZAI01019658    VDP46884.1    UZAI01004358    VDO85816.1    UZAI01003822    VDO82516.1    UZAI01005904    VDO92593.1    DQ008121    AAY56756.1    UZAI01005079    VDO89009.1    UZAL01029745    VDP50123.1    UZAI01017328    VDP23394.1    UZAK01033177    VDP35171.1    UZAI01000649    VDO55264.1    UZAI01016957    VDP18586.1    UZAK01032582    VDP29026.1    UZAK01036789    VDP56667.1    UZAI01017591    VDP27037.1    UZAI01005521    VDO90887.1    GDHC01000226    JAQ18403.1    UZAI01001395    VDO61440.1    UZAI01005384    VDO90304.1    BN000794    CAJ00236.1    DQ008120    AAY56755.1    UZAI01000520    VDO53926.1    UZAI01002571    VDO72770.1    UZAI01021977    VDP56998.1    UZAI01017336    VDP23465.1    UZAH01001330    VDO19666.1    UZAK01037647    VDP59331.1    UZAI01001890    VDO66215.1    UZAI01000872    VDO57178.1    UZAK01032715    VDP30433.1    UZAI01008338    VDP01758.1    UZAI01005620    VDO91334.1    UZAK01005401    VDO87479.1    LSMT01000038    PFX31239.1    UZAK01001851    VDO71852.1    UZAI01002504    VDO72194.1    LSMT01000205    PFX23506.1    UZAK01039677    VDP63363.1    UZAI01001449    VDO62065.1    UZAL01037544    VDP72059.1    UZAI01021315    VDP55115.1    LSMT01001244    PFX12648.1    UZAK01005053    VDO86398.1    UZAK01037506    VDP58946.1    LSMT01000478    PFX17357.1    UZAK01032318    VDP25893.1    LSMT01000057    PFX30003.1    UZAI01020194    VDP50184.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR027124   Swc5/CFDP2       
IPR005135   Endo/exonuclease/phosphatase       
SUPFAM
SSF56219   SSF56219       
Gene 3D
PDB
6AR3     E-value=0.000195823,     Score=102

Ontologies

Topology

Length:
204
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
21.91998
Exp number, first 60 AAs:
0.01704
Total prob of N-in:
0.19439
outside
1  -  204
 
 

Population Genetic Test Statistics

Pi
440.441919
Theta
199.387839
Tajima's D
3.792017
CLR
0
CSRT
0.997600119994
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号