SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01305
Annotation
PREDICTED:_uncharacterized_protein_LOC105842588_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.7
 

Sequence

CDS
ATGGACGATGACGACGGGGGTGAGGGCTTCAGCTCCGCCCCTGTGTCCGCTCCCATAATAATGGGAAAAAGAAGAATGAAGTCATCTGAATACGACGAAAGCCGCAAAATAAAAATGACTTTCATTAAAAATAAGCGCGGTCTTTTTAAAGACCACCATGCTCTTTACGAAGACCTTACAAAAAAAGAATACCCAGTGCTTCTTCAATCAAGCATCTCACAACCAAATAACAGAGTCCCAATGGACCTGTTAAAAATAAACAAAGCATTAAAAAATATTCAAGGGGTCCAGTATGTCAAAGCTGCTGGTACCTTTTTTGCTAAAATTTACTTTGGCTGTGCTCGGGATGCCAACGCTTTTTTATTAAATGTAAGTTTTATGGAGTTAAACAATTGGACAGCAAAAATACCTTACGATAGCATTGAGAGTCAAGGAATTATTCGAGCTCCTGTGGAATTGAACGAAGAATCTCTTTTAGTAAATTTAAAAGCTTCATGCACAATACTCGGAGTAAAAAGATTTTTCAAAAAACAAGAGAATGGAAGTGACAAGCCACTGCAAACTGTGCTGGTTACATTTTTGGCGTCTAGCCATCCTGATCACGTCACATACGAGCATATTTGGATGCCTGTTTCGGATTATATTAGACCTGTGTTACAGTGCTTCAAATGCTACAAATTCGGACATGGAAGTGGTGCCTGTAAAGCCACTCAAGTTTGTTCTATTTGTTCAGGCAATCATTTTTATAAGGAGTGCAGCACTCCCAACATCTTCAAGTGCTCCAACTGCAGTGGGCCACATTCTGCAGTTTCTTACTCTTGCTCAGTAAAGGCAGCCAAGGTTGCTGAAGTAAAAAATAAGATCATCGGCAAGCAAACATCATATGCAGCCATACTAAAGACTCCTGTTATTAAGAACCCCGTGACCTCTTCTGACATACCTATATCTGCGAAGACCCCTCAAGGTAGGGCTTTAATTTCAGACATTATCAATTCAGAAATTGTCATCAGAACCATTACAAAAACTATAATAGAATTGTTAAAGAAAAAGGATTCTAAATCCCCTTCTGGACCTATATCTACTCAATTAATTAAAGAAATGCTAGTAACGAATTTTACATCATAA
Protein
MDDDDGGEGFSSAPVSAPIIMGKRRMKSSEYDESRKIKMTFIKNKRGLFKDHHALYEDLTKKEYPVLLQSSISQPNNRVPMDLLKINKALKNIQGVQYVKAAGTFFAKIYFGCARDANAFLLNVSFMELNNWTAKIPYDSIESQGIIRAPVELNEESLLVNLKASCTILGVKRFFKKQENGSDKPLQTVLVTFLASSHPDHVTYEHIWMPVSDYIRPVLQCFKCYKFGHGSGACKATQVCSICSGNHFYKECSTPNIFKCSNCSGPHSAVSYSCSVKAAKVAEVKNKIIGKQTSYAAILKTPVIKNPVTSSDIPISAKTPQGRALISDIINSEIVIRTITKTIIELLKKKDSKSPSGPISTQLIKEMLVTNFTS

Summary

Interpro
IPR001878   Znf_CCHC        + More
IPR036875   Znf_CCHC_sf       
SUPFAM
SSF57756   SSF57756       

Ontologies

Topology

Length:
374
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.02328
Exp number, first 60 AAs:
0.0008
Total prob of N-in:
0.00370
outside
1  -  374
 
 

Population Genetic Test Statistics

Pi
129.95418
Theta
71.344425
Tajima's D
1.448551
CLR
0.491514
CSRT
0.777561121943903
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号