SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01299
Annotation
Retrovirus-related_Pol_polyprotein_from_transposon_TNT_1-94_[Papilio_machaon]
Location in the cell
Nuclear   Reliability : 2.718
 

Sequence

CDS
ATGTTCCTCACAGATTGTGATCTATGGGACTGTGTAAGTACAGACACACTTGATACTCCTGAATTAAAAAAGAGAGATAGTAAAGCAAGAGCAAAAATATGTCTACTCTTGGAAGAAAACATTTTCCCAATTGTTACCGGTGCCGTAACGGCAAAACAAACATGGGATGCGTTAGAAAAGGCCTACGCCGATGGCGGACTGTTAAGACGACTCACTTTATTAAGAAAATTATTTAATTTGAAATTATCATGTTTCGTAAATATCGAAGCATACATCAATGAAGTGCAGGCGACAAGTCAGGCTTTACAGCGAATCAAATCAGGACTGGATGATGAATTCATTGGGATCATAATGTTAGCTGGGTTGACCGAGGAATACAATCCTTTGGTGATGGCGGTGGAACATTCTGAAAGGAAATTAACTTCAGAAGCGGTCATATCTGCTCTAATGAAGGAAGGACAGCGCAAGCAGCCGGCAGTTGAAATGGATTCTGTGTTAGTGTCTAATAACGAAAAACCTAGTAGTAGTACGAAAAAGGCAATAATATGTCATTTTTGTAAAAAGAAAGGTCATTTTAAATGGCAATGTAAATTTTATAAAGATAGGGATAAGAAAGGTAATGCAAATGTATGCGTAGCTCAAAAGGAGACTAATGATTTTATTACCTTACTCTCTAATATGGGAAAGTCGAGAAATTGGATTATAGATTCTGGGGCAACATCTCATATGACATCATCAGATAATGTTTTAGTAAATGCTAAAGGTGGTTACCGGAAGTATATAACTACAGCTAATAATGAGAAAATATTATCTAAGGTAAAGGGTGATGTATTGATGCCTAATTATAAGTTAAAGTTTGAGAATGTTTTGTACATACCAGATTTGATAACCAATTTACTTTCTGTTAGTAGTATTTGTAAGCATGATTGTACAGTTGTTTTTGATAAACATTCTTGTAAAGTTTACAAATCTGCAGATGTATCCTTAGTGGGAAAAACTATTTTAGAAGCACCTTTAAAAGATGGGCTATATGTAGTAGACCGAGATGACAAGGCATTGGTTACTAAAGACATTAATTCGCCTGTTAACGATCAATATAAGTTATGGCATAGGCGTTTAGGTCATTTATCACCAGCTCTAATGAATAAATTAAGAGGGTTGGTTGATGGCTTTACCTTGAATGAATTTAGTAAGGAACCATGCGTCAGTTGTTGTAAAGGTAAACAGTGCGTAAAAAAGTTCCCAAAAAGAAAGAATAAAAGAGCTAAGGATATATTGAGGATATATATGGAGGAAGAGACATGGGGTGGTGCTCGATATTTTCTTATCTTTGTTGACGATTTTAGTCGGAAAGTTATGGGATATATGTTGAAATCCAAAACAGAAGTATTTGCTAAATTTAAGGAATTCAAGGTGTTTGTGGAGAATCAAACTAATAAAAAGATCAAAAAATTGCGTAGCGATAATGGTACTGAATATATAAACGATGAATTTCAAAGCTTTCTACGAGCTAATGGTATCCATCATCAGACTTCAGTGGCACACACTCCACAACAAAATGGAGTGGCAGAGCGTACAATTCGTACTGTAATTGAAAAGGCACGTTATCCTAAATCAGTTGAGGACGCATTGGAACGTTCGGATCGAGAGTTATGGCACACAGCCATGTTAGATGGATACAATTCGCTGATGCAAAACAAAAACAGTGAACAGAATTAA
Protein
MFLTDCDLWDCVSTDTLDTPELKKRDSKARAKICLLLEENIFPIVTGAVTAKQTWDALEKAYADGGLLRRLTLLRKLFNLKLSCFVNIEAYINEVQATSQALQRIKSGLDDEFIGIIMLAGLTEEYNPLVMAVEHSERKLTSEAVISALMKEGQRKQPAVEMDSVLVSNNEKPSSSTKKAIICHFCKKKGHFKWQCKFYKDRDKKGNANVCVAQKETNDFITLLSNMGKSRNWIIDSGATSHMTSSDNVLVNAKGGYRKYITTANNEKILSKVKGDVLMPNYKLKFENVLYIPDLITNLLSVSSICKHDCTVVFDKHSCKVYKSADVSLVGKTILEAPLKDGLYVVDRDDKALVTKDINSPVNDQYKLWHRRLGHLSPALMNKLRGLVDGFTLNEFSKEPCVSCCKGKQCVKKFPKRKNKRAKDILRIYMEEETWGGARYFLIFVDDFSRKVMGYMLKSKTEVFAKFKEFKVFVENQTNKKIKKLRSDNGTEYINDEFQSFLRANGIHHQTSVAHTPQQNGVAERTIRTVIEKARYPKSVEDALERSDRELWHTAMLDGYNSLMQNKNSEQN

Summary

EMBL
KQ460882    KPJ11482.1    GBHO01011746    GBHO01011744    GBHO01011742    JAG31858.1    + More
JAG31860.1    JAG31862.1    LBMM01004924    KMQ91985.1    JYDJ01000877    KRX33198.1    NWSH01002292    PCG68657.1    PCG68658.1    GEZM01045162    JAV77889.1    JYDS01000009    JYDV01000021    KRZ33483.1    KRZ41218.1    JYDR01000001    KRY80095.1    JYDH01000330    KRY26802.1    NWSH01000816    PCG74073.1    JYDT01000069    KRY86576.1    JYDJ01000808    KRX33413.1    GAKP01015352    JAC43600.1    JYDJ01000136    KRX42725.1    GEZM01011858    GEZM01011854    JAV93389.1    JYDK01000071    KRX78146.1    GBXI01011094    JAD03198.1    GEZM01011856    JAV93393.1    GEZM01011857    JAV93390.1    KQ460208    KPJ16606.1    GANO01000510    JAB59361.1    KQ460297    KPJ16236.1    KL367628    KFD61291.1    KRX78123.1    KL367553    KFD64618.1    KQ459875    KPJ19636.1    AGBW02009826    OWR49812.1    GBHO01026221    JAG17383.1    GEHC01000991    JAV46654.1    GANO01000659    JAB59212.1    GANO01000660    JAB59211.1    GEHC01000990    JAV46655.1    GFTR01008662    JAW07764.1    JYDQ01000379    KRY07987.1    GEHC01000989    JAV46656.1    NEVH01019375    PNF22597.1    GEHC01000988    JAV46657.1    NEVH01002725    PNF41351.1    NEVH01006980    PNF36330.1    GBHO01003630    JAG39974.1    GDHC01012180    JAQ06449.1    NEVH01006721    PNF37230.1    JYDL01000297    KRX12674.1    GALX01001351    JAB67115.1    GEDC01002834    JAS34464.1    LBMM01017716    KMQ83988.1    JXUM01099713    KQ564513    KXJ72145.1    GEHC01000868    JAV46777.1    GEHC01000867    JAV46778.1    JYDU01000039    KRX96809.1    GEZM01013472    GEZM01013471    GEZM01013470    JAV92539.1    JYDU01000010    KRY00136.1    GBHO01036544    JAG07060.1    JYDP01000032    KRZ13440.1    JYDU01000001    KRY01876.1    LBMM01013295    KMQ85718.1    GEHC01000965    JAV46680.1    GBHO01020706    JAG22898.1    GBHO01033237    JAG10367.1    GBYX01207955    JAO77249.1    AAZX01000798    GDHF01030254    JAI22060.1    JYDT01000024    KRY90099.1    GBHO01033235    JAG10369.1    GDHF01029191    JAI23123.1    GBHO01026223    JAG17381.1    GAMC01008189    JAB98366.1    GBHO01036147    JAG07457.1    GBHO01036148    JAG07456.1    GAMC01018156    JAB88399.1    LBMM01012669    KMQ86061.1    GAMC01018154    JAB88401.1    GAMC01018157    JAB88398.1    GBXI01000292    JAD14000.1    GBXI01016677    JAC97614.1    GAMC01020352    JAB86203.1    GDUN01000214    JAN95705.1    AAZX01023884    GAKP01008575    JAC50377.1    GBXI01007143    JAD07149.1    MLYV02000620    PSR81378.1    GBXI01002679    JAD11613.1    JXUM01077078    KQ562985    KXJ74708.1    LBMM01014442    KMQ85179.1    KA648745    AFP63374.1    GAMC01011082    JAB95473.1    NWVJ01000098    PCG17690.1    JYDN01000113    KRX56900.1    CM007899    OTG12557.1    JYDP01000350    KRZ01021.1    GEFH01000951    JAP67630.1    FJ238509    ACI62137.1   
Pfam
PF13976   gag_pre-integrs        + More
PF00665   rve
PF13961   DUF4219
PF07727   RVT_2
PF00098   zf-CCHC
PF00078   RVT_1
PF14244   Retrotran_gag_3
Interpro
IPR036875   Znf_CCHC_sf        + More
IPR012337   RNaseH-like_sf       
IPR001878   Znf_CCHC       
IPR013103   RVT_2       
IPR001584   Integrase_cat-core       
IPR039537   Retrotran_Ty1/copia-like       
IPR025314   DUF4219       
IPR025724   GAG-pre-integrase_dom       
IPR036397   RNaseH_sf       
IPR000477   RT_dom       
IPR029472   Copia-like_N       
SUPFAM
SSF53098   SSF53098        + More
SSF57756   SSF57756       
Gene 3D
PDB
5T3A     E-value=0.0157647,     Score=91

Ontologies

Topology

Length:
572
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0377400000000001
Exp number, first 60 AAs:
0.03228
Total prob of N-in:
0.00227
outside
1  -  572
 
 

Population Genetic Test Statistics

Pi
351.681561
Theta
156.592287
Tajima's D
3.94563
CLR
0.343657
CSRT
0.998800059997
Interpretation
Possibly Balancing Selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号