SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01263  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA009027
Annotation
B_Chain_B?_Crystal_Structure_Of_Bombyx_Mori_Sp2/sp3_Heterohexamer
Full name
Arylphorin subunit alpha       + More
Arylphorin subunit beta      
Arylphorin      
Sex-specific storage-protein 2      
Alternative Name
Arylphorin
Location in the cell
Extracellular   Reliability : 3.144
 

Sequence

CDS
ATGAAGACTGTCTTGATTTTAGCGGGGCTTATTGCCCTCGCTCTCAGTAGCACCGTACCTGAATTCAAAACGACACCGGTTGACGCTGCGTTCGTCGAAAAGCAAAAGAAGATTTTGTCTCTTTTCTACAACGTTAACGAGATCAGCTATGAAGCTGAGTACTACAAAGTCGCCCAGGACTTCAACATCGAGGCCAGCAAGGACTGCTACACAAACATGAAAGCCTACGAAAATTTCATGATGATGTACAAGGTCGGATTCCTTCCCAAGAATTTGGAATTCTCGATCTTTTACGAAAAAATGAGGGAAGAAGCCATCGCGCTGTTCAAGCTGTTCTATTATGCCAAAGATTTTGAATGTTTCTACAAAACAGCATGCTACGCCAGAGTCTACATGAACCAGGGAATGTTCTTATACGCCTACTACATAGCTATTATCCAGCGCTCTGACACCGCCAGCTTCGTTCTACCTGCTCCATACGAAGCTTATCCTCAATATTTTGTCAACATGGAAGTTAAAAATAAAATGGACTACGTTAAGATGATGGATGGTTGCCTTGACGAGAAAATATGTTATAATTACGGAATTATCAAAGAAAACGAACAATTCGTAATGTACGCCAACTATTCCAATTCCCTGACTTACCCCAACAACGAAGACAGAATTGCTTACTTAACTGAAGATGTTGGCCTAAATGCTTATTATTACTATTTCCACTCACACTTACCGTTCTGGTGGAACTCTGGTAAATACGGAGCTTTCAAGGAACGTCGTGGGGAAATCTACTTCTTCTTCTACCAACAACTGTTAGCTCGTTACTACATGGAGCGTCTTACCAATGGATTGGGTAAAATCCCTGAGTTTTCCTGGTACTCGCCTCTTCGAACTGGCTACCTCCCGCCTTTCAACTCCTTTTATTATCCATTTGCCCAAAGAAGCAATGACTACGAGTTGCACACCGAGAAGAACTACGAAGAAATTCGCTTCCTCGACATTTATGAGAAGACATTCTTCCAATACCTCCAGCAAGGTCACTTCAAGGCCTTCGACAAAAAAATTGATCTGCACAGTAGCAAAGCAGTCAACTTTGTGGGCAACTACTGGCAGACGAACGCCGATCTATTCGAAGAAGACTTCCTCCAATTCTACCAGCGTTCTTACGAGGTTAACGCTCGCCGCGTACTTGGTGCTGCTCCTAAGCCTTTCAACCAGTACACATTTATTCCTAGTGCTCTTGACTTCTACCAAACTTCGGCCAGGGACCCAGCCTTCTACCAGCTCTATAAAAGAATTGTTCAATACATCATCGAATTTAAACAGTACCAGGTACCATACACACAAGAAGCTCTTCACTTCGTTGGTCTGAAAATTTCCGACGTCAAAGTCGACAAAATGGTCACATTCTTTGACCATTTCGACTTCGATGCCTTCAACACTGTCTACTTCAGTAAAGAAGAACTCAAGAGCTCTCCTCACGGTTACAAGGTCCGTCAACCACGTCTTAACCACAAGCCGTTCACTGTGACAATCGATATTAAATCTGATGTTGCCACTAACGCCGTCGTCAAGATGTTCCTTGGACCTAAATACGATGAGAACGGCTTTCCCTTCAGCCTAGAAGATAACTGGATGAACTTCTACGAGCTTGACTGGTTCGTGCAAAAGGTTAACCCTGGCCAGTCTCAGATAACGCGTTCATCTACTGACTTTGCATTCTTCAAAGAAGACTCTTTACCGATGGCCGAAATCTACAAGCTCTTGGACCAAGGAAAGATTCCTACTGACATGTTCAACTCCTCGGACACTATGCCTTCGAGGCTGATGCTGCCTAAGGGTACATACGATGGATTCCCCTTCCAGCTGTTTGTATTCGTCTATCCGTATGAACCGACACCTAAGGAGTCAGAGCCATTCAAGTCTGTTGTTCCGGACAACAAACCATTCGGTTATCCATTCGATCGCCCCGTTCTTCCTCAGTACTTCAAACAACCTAACATGTTCTTCAAGAAGGTCCTGGTCTACCATGAAGGAGAACTATTCCCCTATCTATTTAACATTCCTCACTATACACCAGATAAAGCGCAACTATAA
Protein
MKTVLILAGLIALALSSTVPEFKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPHYTPDKAQL

Summary

Description
Arylphorin is a larval storage protein (LSP) which may serve as a storage protein used primarily as a source of aromatic amino acids for protein synthesis during metamorphosis. It is a constituent of the sclerotizing system of the cuticle, and serves as a carrier for ecdysteroid hormone (By similarity).
Subunit
Arylphorin is a hexamer of subunits alpha and beta.
Homohexamer of two stacked trimers; disulfide-linked.
Similarity
Belongs to the hemocyanin family.
Keywords
Glycoprotein   Secreted   Signal   Storage protein   3D-structure   Disulfide bond   Complete proteome   Reference proteome  
Feature
chain  Arylphorin subunit alpha
EMBL
BABH01012849    JQ043182    AFD02109.1    JN581664    AET36899.1    M28394    + More
M28396    BABH01012853    DQ443358    ABF51447.1    AB288052    BAF42699.1    AF032396    AAB86644.1    M28395    M28397    JN676156    AFP55241.1    KZ150082    PZC73856.1    JN676155    AFP55240.1    AY278025    EF597564    D44483    KY419217    AVC68643.1    PZC73855.1    M24370    M24371    AB019209    KX462992    AOG20786.1    JN315688    AEO51737.1    ODYU01008226    SOQ51635.1    NWSH01003382    PCG66422.1    NWSH01005808    PCG63931.1    JTDY01000570    KOB76643.1    KY419214    AVC68640.1    KQ460597    KPJ13878.1    AK401096    BAM17718.1    KQ459591    KPI97034.1    AJ249471    CAB55605.1    GDQN01008711    JAT82343.1    AGBW02013638    OWR43054.1    GDQN01003207    JAT87847.1    SOQ51636.1    M73793    AAA74229.1    GDQN01004040    JAT87014.1    EU661547    ACF70482.1    AF294808    AAG44959.1    AF294809    AAG44960.1    KF687948    AIM56832.1    AB253735    BAF32562.1    GU362706    ADC68623.1    KY924788    ASA46442.1    AB248058    BAE98325.1    AB253734    BAF32561.1    EF429084    ABO27097.1    CH477534    EAT39409.1    JXUM01081717    KQ563264    KXJ74179.1    DS231974    EDS29983.1    ADMH02002026    ETN59893.1    CH478096    EAT33977.1    ADMH02000246    ETN67251.1    CH477731    EAT36773.1    JXUM01025392    KQ560720    KXJ81155.1    GAMD01002885    JAA98705.1    DS231835    EDS32904.1    JXUM01100592    KQ564582    KXJ72065.1    AXCN02000261    AXCM01007233    AAAB01008987    EAA01166.5    APCN01000846    GAMD01000727    JAB00864.1    U86080    AAB46714.1    APCN01000900    EAA01337.5    AXCM01011608    ATLV01015833    KE525036    KFB40820.1    EDS32906.1    AJVK01012873    AJWK01034743    AXCN02000206    JXUM01123104    KQ566681    KXJ69911.1    EAT33979.1    CVRI01000070    CRL07340.1    ATLV01022440    KE525332    KFB47673.1   
Pfam
PF03722   Hemocyanin_N        + More
PF03723   Hemocyanin_C
PF00372   Hemocyanin_M
Interpro
IPR013788   Hemocyanin/hexamerin        + More
IPR008922   Unchr_di-copper_centre       
IPR014756   Ig_E-set       
IPR005204   Hemocyanin_N       
IPR000896   Hemocyanin/hexamerin_mid_dom       
IPR036697   Hemocyanin_N_sf       
IPR005203   Hemocyanin_C       
IPR037020   Hemocyanin_C_sf       
SUPFAM
SSF81296   SSF81296        + More
SSF48056   SSF48056       
SSF48050   SSF48050       
PDB
3WJM     E-value=0,     Score=3213

Ontologies

Topology

Subcellular location
  
SignalP
Position:   1 - 16,         Likelihood:  0.996959
 
 
Length:
696
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.95271
Exp number, first 60 AAs:
0.77563
Total prob of N-in:
0.07034
outside
1  -  696
 
 

Population Genetic Test Statistics

Pi
171.983001
Theta
166.136522
Tajima's D
-1.36562
CLR
2.340953
CSRT
0.0786960651967402
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
25860555 IDENFAVVSR 96.00 4e-10
26280517 SDTAFCQMVEAAYK 96.00 4e-10
24402669 SDSGIYVCSIYNR 96.00 4e-10
28467696 SDTAFCQMVEAAYK 96.00 4e-10
25860555 DGIAITISNDVQGDDGRPAYGDGKDK 95.65 3e-09
26280517 SVSQPVETGTASEVDYDWIPK 95.65 3e-09
25044914 SVVINPNAVDISTSR 95.65 3e-09
24402669 SVVPDNKPFGYPFDR 95.65 3e-09
28467696 SVVIMSHIGRPDGQVNIK 95.65 3e-09
24402669 GTSISSTQGK 95.45 2e-08
20822545 TVLILAGLIALALSSTVPEFK 100.00 1e-06
20822545 TGYLPPFNSFYYPFAQR 100.00 1e-06
20822545 LTNGLGKIPEFSWYSPLR 100.00 1e-06
20822545 TVLILAGLIALALSSTVPEFK 100.00 1e-06
20822545 TGYLPPFNSFYYPFAQR 100.00 1e-06
20822545 TGYLPPFNSFYYPFAQR 100.00 3e-06
25860555 EVVQAIESDPDFRER 100.00 3e-06
26280517 VAIVTASTEGIGYAIAK 100.00 3e-06
24402669 VAQDFNIEASK 100.00 3e-06
28467696 VAQDFNIEASK 100.00 3e-06
20822545 SSTDFAFFKEDSLPMAEIYK 100.00 2e-05
20822545 SNDYELHTEKNYEEIR 100.00 2e-05
20822545 SNDYELHTEKNYEEIR 100.00 2e-05
20822545 SNDYELHTEKNYEEIR 100.00 2e-05
20822545 SNDYELHTEKNYEEIR 100.00 2e-05
20822545 SNDYELHTEKNYEEIR 100.00 2e-05
20822545 RGEIYFFFYQQLLAR 100.00 3e-05
20822545 RGEIYFFFYQQLLAR 100.00 3e-05
20822545 SSTDFAFFKEDSLPMAEIYK 100.00 1e-04
24402669 SVVIMSHIGRPDGQVNIK 100.00 4e-04
20822545 GEIYFFFYQQLLAR 100.00 5e-04
20822545 GEIYFFFYQQLLAR 100.00 5e-04
26280517 INNQGGYTEEFSVR 100.00 7e-04
24402669 IPSGDEMPVR 100.00 7e-04
28467696 IPSVQPNIDYSDCVK 100.00 7e-04
20822545 RGEIYFFFYQQLLAR 100.00 0.002
20822545 RGEIYFFFYQQLLAR 100.00 0.002
20822545 QYQVPYTQEALHFVGLK 100.00 0.002
20822545 RGEIYFFFYQQLLAR 100.00 0.002
20822545 QYQVPYTQEALHFVGLK 100.00 0.002
20822545 IPEFSWYSPLR 100.00 0.022
20822545 IPEFSWYSPLR 100.00 0.022
20822545 IPEFSWYSPLR 100.00 0.022
20822545 IPEFSWYSPLR 100.00 0.022
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号