SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01262  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA009028
Annotation
sex-specific_storage-protein_2_precursor_[Bombyx_mori]
Full name
Sex-specific storage-protein 2       + More
Arylphorin subunit beta      
Arylphorin      
Arylphorin subunit alpha      
Alternative Name
Arylphorin
Location in the cell
Extracellular   Reliability : 2.64
 

Sequence

CDS
ATGGCTAGAAGATACAAAGGCTTCTTCTTTAACAGGATAAGAGGATACAGAGTTTCTTCTTTCACAAGACACAGAGGATACAGGGTTTTCTTCTTTCACAGGACGCAGAGTTTTCTTCTTTCACGAGACACAGAGAATACAGAGTTACTTACAGGATACAGAGTGGATGCCGTATTTGTTGAAAAGCAAAAGAAAATTCTGTCCTTCTTCCAAGATGTGAGCCAACTAAACACTGATGATGAATATTATAAAATTGGCAAAGACTATGATATCGAAATGAATATGGACAACTACACTAACAAGAAAGCTGTTGAAGAATTTCTGAAGATGTACAGGACTGGTTTTATGCCTAAGAATTTAGAGTTCTCCGTTTTTTATGACAAGATGAGGGATGAAGCTATTGCTCTATTCCATTTATTCTATTACGCTAAGGACTTTGAAACGTTCTACAAGACTGCCTGTTTTGCGCGTGTGCATCTCAATCAAGGTCAATTCTTGTATGCCTTCTACATCGCTGTTATCCAGCGCTCTGATTGCCACGGTTTCGTTGTTCCTGCTCCGTATGAAGTATACCCTAAAATGTTTATGAATATGGAAGTGCTGCAAAAAATTTACGTAACAAAGATGCAAGATGGCCTCATTAATCCTGAAGCCGCAGCTAAGTATGGCATTCACAAGGAAAACGACTACTTCGTTTACAAAGCCAATTATTCTAACGCCGTTTTATACAATAATGAAGAACAAAGGCTGACATACTTCACTGAGGATATTGGCATGAACGCTTACTACTACTACTTCCACTCTCATTTACCGTTCTGGTGGACATCAGAAAAATACGGAGCCCTTAAAGAGCGTCGTGGAGAGGTTTACTTCTACTTCTACCAGCAATTATTGGCTCGTTACTACTTTGAGCGTCTTACCAATGGACTTGGTAAGATTCCCGAATTCTCATGGTACTCTCCGATAAAGACTGGATACTATCCATTGATGCTAACTAAGTTTACACCCTTCGCACAAAGACCTGACTACTACAACTTGCACACCGAAGAAAACTATGAAAGAGTAAGATTCCTTGACACTTATGAGAAGACATTCGTTCAGTTCCTCCAAAAGGACCACTTTGAAGCCTTCGGACAAAAAATTGATTTCCACGACCCGAAAGCCATTAACTTCGTCGGCAACTACTGGCAAGATAATGCAGATCTGTATGGAGAAGAAGTCACAAAAGATTACCAACGTTCTTACGAAGTATTTGCGCGCCGTGTGCTAGGTGCTGCGCCTATGCCATTCGACAAGTACACTTTCATGCCTAGTGCAATGGACTTTTACCAGACTTCTCTTCGTGATCCTGCTTTCTATCAGCTCTACAACAGAATTGTGGAATACATCGTTGAGTTCAAGCAATACTTGAAGCCTTACACTCAAGACAAACTTTACTTTGATGGTGTCAAGATAACTGATGTTAAAGTCGATAAATTGACAACATTCTTCGAGAACTTTGAATTCGACGCCAGCAACAGCGTGTACTTTAGTAAAGAGGAGATTAAGAACAACCACGTCCATGACGTTAAGGTGCGCCAGCCACGATTGAACCACAGCCCCTTCAACGTTAACATTGAGGTTGATTCTAATGTCGCCAGTGACGCTGTTGTCAAAATCTTCCTGGCTCCCAAATACGATGACAACGGAATACCTCTCACATTAGAGGACAACTGGATGAAATTCTTCGAGTTGGACTGGTTCACAACTAAACTCACCGCTGGTCAGAACAAGATTATCCGCAATTCGAATGAATTTGTCATATTTAAAGAAGACTCCGTGCCAATGACTGAAATTATGAAGATGCTCGACGAAGGAAAAGTACCTTTTGATATGTCGGAAGAGTTCTGTTACATGCCTAAAAGACTCATGCTGCCTAGAGGTACTGAAGGTGGATTCCCATTCCAGCTCTTTGTTTTCGTCTATCCATTCGACAACAAAGGCAAGGACTTGGCTCCTTTCGAATCTTTTGTTCTTGACAATAAGCCTCTTGGCTTCCCTCTGGATCGCCCCGTTGTTGATGCATTATTCAAGGTTCCTAACATGTATTTCAAGGATATTTTCATTTACCACGAGGGTGAACGGTTCCCTTACAAATTCAATATTCCTTCGTATGACACACAGTCTAATGTTGTTCCAAAAAATTAA
Protein
MARRYKGFFFNRIRGYRVSSFTRHRGYRVFFFHRTQSFLLSRDTENTELLTGYRVDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLKMYRTGFMPKNLEFSVFYDKMRDEAIALFHLFYYAKDFETFYKTACFARVHLNQGQFLYAFYIAVIQRSDCHGFVVPAPYEVYPKMFMNMEVLQKIYVTKMQDGLINPEAAAKYGIHKENDYFVYKANYSNAVLYNNEEQRLTYFTEDIGMNAYYYYFHSHLPFWWTSEKYGALKERRGEVYFYFYQQLLARYYFERLTNGLGKIPEFSWYSPIKTGYYPLMLTKFTPFAQRPDYYNLHTEENYERVRFLDTYEKTFVQFLQKDHFEAFGQKIDFHDPKAINFVGNYWQDNADLYGEEVTKDYQRSYEVFARRVLGAAPMPFDKYTFMPSAMDFYQTSLRDPAFYQLYNRIVEYIVEFKQYLKPYTQDKLYFDGVKITDVKVDKLTTFFENFEFDASNSVYFSKEEIKNNHVHDVKVRQPRLNHSPFNVNIEVDSNVASDAVVKIFLAPKYDDNGIPLTLEDNWMKFFELDWFTTKLTAGQNKIIRNSNEFVIFKEDSVPMTEIMKMLDEGKVPFDMSEEFCYMPKRLMLPRGTEGGFPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNIPSYDTQSNVVPKN

Summary

Description
Arylphorin is a larval storage protein (LSP) which may serve as a storage protein used primarily as a source of aromatic amino acids for protein synthesis during metamorphosis. It is a constituent of the sclerotizing system of the cuticle, and serves as a carrier for ecdysteroid hormone (By similarity).
Subunit
Arylphorin is a hexamer of subunits alpha and beta.
Homohexamer of two stacked trimers; disulfide-linked.
Similarity
Belongs to the hemocyanin family.
Keywords
Complete proteome   Glycoprotein   Reference proteome   Secreted   Signal   Storage protein   3D-structure   Disulfide bond  
Feature
chain  Sex-specific storage-protein 2
EMBL
BABH01012853    DQ443358    ABF51447.1    M24370    M24371    AB019209    + More
AF032396    AAB86644.1    AB288052    BAF42699.1    M28395    M28397    AY278025    EF597564    D44483    M28394    M28396    JN581664    AET36899.1    BABH01012849    JQ043182    AFD02109.1    JN676155    AFP55240.1    KZ150082    PZC73855.1    JN315688    AEO51737.1    PZC73856.1    KX462992    AOG20786.1    JN676156    AFP55241.1    KY419217    AVC68643.1    NWSH01005808    PCG63931.1    NWSH01003382    PCG66422.1    ODYU01008226    SOQ51635.1    KY419214    AVC68640.1    AJ249471    CAB55605.1    KQ460597    KPJ13878.1    JTDY01000570    KOB76643.1    AK401096    BAM17718.1    KQ459591    KPI97034.1    GDQN01008711    JAT82343.1    AGBW02013638    OWR43054.1    SOQ51636.1    GDQN01003207    JAT87847.1    M73793    AAA74229.1    GDQN01004040    JAT87014.1    AF294808    AAG44959.1    AB253735    BAF32562.1    AF294809    AAG44960.1    KF687948    AIM56832.1    EU661547    ACF70482.1    KY924788    ASA46442.1    GU362706    ADC68623.1    AB253734    BAF32561.1    AB248058    BAE98325.1    EF429084    ABO27097.1    JXUM01081717    KQ563264    KXJ74179.1    CH478096    EAT33977.1    CH477731    EAT36773.1    ADMH02000246    ETN67251.1    AXCM01007233    DS231835    EDS32904.1    DS231974    EDS29983.1    U86080    AAB46714.1    CH477534    EAT39409.1    JXUM01025392    KQ560720    KXJ81155.1    JXUM01100592    KQ564582    KXJ72065.1    GAMD01000727    JAB00864.1    AXCN02000261    EDS32906.1    AJVK01012873    AAAB01008987    EAA01337.5    APCN01000900    AJWK01034743    EAA01166.5    APCN01000846    ADMH02002026    ETN59893.1    ATLV01015833    KE525036    KFB40820.1    GAMD01002885    JAA98705.1    JXUM01123104    KQ566681    KXJ69911.1    EAT33979.1    AXCM01011608    GBYB01008354    JAG78121.1    PZC73861.1    JX914501    AGG22606.1    ATLV01022440    KE525332    KFB47673.1   
Pfam
PF03723   Hemocyanin_C        + More
PF03722   Hemocyanin_N
PF00372   Hemocyanin_M
Interpro
IPR036697   Hemocyanin_N_sf        + More
IPR005203   Hemocyanin_C       
IPR000896   Hemocyanin/hexamerin_mid_dom       
IPR014756   Ig_E-set       
IPR005204   Hemocyanin_N       
IPR008922   Unchr_di-copper_centre       
IPR013788   Hemocyanin/hexamerin       
IPR037020   Hemocyanin_C_sf       
SUPFAM
SSF48056   SSF48056        + More
SSF48050   SSF48050       
SSF81296   SSF81296       
PDB
3WJM     E-value=0,     Score=3279

Ontologies

Topology

Subcellular location
  
Length:
728
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.06742
Exp number, first 60 AAs:
0.00096
Total prob of N-in:
0.00248
outside
1  -  728
 
 

Population Genetic Test Statistics

Pi
206.269861
Theta
162.193217
Tajima's D
0.6288
CLR
0.222126
CSRT
0.545172741362932
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
24402669 TACFARVHINQGQFIYAFYIAVIQR 95.24 8e-23
25044914 ITTFFENFEFDASNSVYFSKEEIK 96.88 1e-14
24402669 ITTFFENFEFDASNSVYFSKEEIK 96.88 1e-14
31223520 DLAPFESFVLDNKPLGFPLDRPVVDALFK 100.00 1e-14
31223520 DLAPFESFVLDNKPLGFPLDRPVVDALFK 100.00 1e-14
24402669 DIFIYHEGERFPYK 100.00 4e-14
31223520 AINFVGNYWQDNADLYGEEVTKDYQR 100.00 6e-13
31223520 AINFVGNYWQDNADLYGEEVTKDYQR 100.00 6e-13
31223520 FTPFAQRPDYYNLHTEENYER 100.00 3e-12
31223520 FTPFAQRPDYYNLHTEENYER 100.00 3e-12
31223520 FTPFAQRPDYYNLHTEENYER 100.00 3e-12
31223520 FTPFAQRPDYYNLHTEENYER 100.00 3e-12
25860555 IFYFTPVVEKDFGDDHFITEDPEVIISQGK 96.15 6e-12
26280517 AIKESFDDIFNEIKK 96.15 6e-12
25044914 AINDHHVYIEGTIIKPNMVTAGQSCK 96.15 6e-12
24402669 AINFVGNYWQDNADIYGEEVTK 96.15 6e-12
28467696 AINFVGNYWQDNADIYGEEVTK 96.15 6e-12
25044914 VDKITTFFENFEFDASNSVYFSK 96.30 1e-10
24402669 VDKITTFFENFEFDASNSVYFSK 96.30 1e-10
20822545 NSNEFVIFKEDSVPMTEIMK 100.00 3e-09
20822545 VHLNQGQFLYAFYIAVIQR 100.00 3e-09
20822545 ILSFFQDVSQLNTDDEYYK 100.00 3e-09
20822545 VHLNQGQFLYAFYIAVIQR 100.00 3e-09
20822545 HLNQGQFLYAFYIAVIQR 100.00 3e-09
31223520 KILSFFQDVSQLNTDDEYYK 100.00 3e-09
31223520 KILSFFQDVSQLNTDDEYYK 100.00 3e-09
31223520 KILSFFQDVSQLNTDDEYYK 100.00 3e-09
31223520 KILSFFQDVSQLNTDDEYYK 100.00 3e-09
31223520 MLDEGKVPFDMSEEFCYMPK 100.00 3e-09
31223520 MLDEGKVPFDMSEEFCYMPK 100.00 3e-09
31223520 MLDEGKVPFDMSEEFCYMPK 100.00 3e-09
31223520 MLDEGKVPFDMSEEFCYMPK 100.00 3e-09
31223520 NSNEFVIFKEDSVPMTEIMK 100.00 3e-09
31223520 NSNEFVIFKEDSVPMTEIMK 100.00 3e-09
25860555 MNDHSISPK 95.65 6e-09
26280517 INCGQAEEIIIQAENEINIAR 95.65 6e-09
25044914 INHSINDQQINWFK 95.65 6e-09
24402669 INHQPFK 95.65 6e-09
28467696 INHSINDQQINWFK 95.65 6e-09
31223520 AINFVGNYWQDNADLYGEEVTK 100.00 2e-08
31223520 AINFVGNYWQDNADLYGEEVTK 100.00 2e-08
31223520 AINFVGNYWQDNADLYGEEVTK 100.00 2e-08
31223520 AINFVGNYWQDNADLYGEEVTK 100.00 2e-08
31223520 AINFVGNYWQDNADLYGEEVTK 100.00 2e-08
31223520 AINFVGNYWQDNADLYGEEVTK 100.00 2e-08
25044914 ITTFFENFEFDASNSVYFSK 95.83 2e-08
24402669 ITTFFENFEFDASNSVYFSK 95.83 2e-08
25860555 VIEISR 95.45 2e-08
26280517 AIITVWAEHMSEDCR 95.45 2e-08
24402669 AINDHHVYIEGTIIKPNMVTAGQSCK 95.45 2e-08
28467696 AINEIGEAVTSSTIFVQSK 95.45 2e-08
25860555 GTMVANINGEVIEKK 95.24 3e-08
26280517 FTIDCTHPAEDSIIDVGNFEK 95.24 3e-08
24402669 FTPFAQR 95.24 3e-08
27102218 QRNDESQGSAIK 95.24 3e-08
28467696 FTPEKDVIDIK 95.24 3e-08
31223520 LNHSPFNVNIEVDSNVASDAVVK 100.00 6e-08
31223520 LNHSPFNVNIEVDSNVASDAVVK 100.00 6e-08
31223520 NSNEFVIFKEDSVPMTEIMK 100.00 6e-08
31223520 LNHSPFNVNIEVDSNVASDAVVK 100.00 6e-08
31223520 LNHSPFNVNIEVDSNVASDAVVK 100.00 6e-08
31223520 NSNEFVIFKEDSVPMTEIMK 100.00 6e-08
26280517 VDISNKPSIGIVSR 95.65 6e-08
25044914 VDKGVVPIFGSEDECTTQGIDDIAQR 95.65 6e-08
24402669 VDIVDKYSSDVDVQK 95.65 6e-08
20822545 VHLNQGQFLYAFYIAVIQR 100.00 2e-07
31223520 IGKDYDIEMNMDNYTNKK 100.00 2e-07
31223520 IGKDYDIEMNMDNYTNKK 100.00 2e-07
31223520 IGKDYDIEMNMDNYTNKK 100.00 2e-07
31223520 IGKDYDIEMNMDNYTNKK 100.00 2e-07
20822545 ILSFFQDVSQLNTDDEYYK 100.00 9e-07
31223520 ILSFFQDVSQLNTDDEYYK 100.00 9e-07
31223520 ILSFFQDVSQLNTDDEYYK 100.00 9e-07
31223520 ILSFFQDVSQLNTDDEYYK 100.00 9e-07
31223520 ILSFFQDVSQLNTDDEYYK 100.00 9e-07
31223520 ILSFFQDVSQLNTDDEYYK 100.00 9e-07
31223520 ILSFFQDVSQLNTDDEYYK 100.00 9e-07
25860555 KIDIAPTVESDAAAIPEIK 100.00 9e-07
26280517 NPYTTFGINK 100.00 9e-07
24402669 NSNEFVIFK 100.00 9e-07
28467696 NSNEFVIFK 100.00 9e-07
31223520 NSNEFVIFKEDSVPMTEIMK 100.00 1e-06
31223520 MLDEGKVPFDMSEEFCYMPK 100.00 1e-06
31223520 NSNEFVIFKEDSVPMTEIMK 100.00 1e-06
31223520 MLDEGKVPFDMSEEFCYMPK 100.00 1e-06
24402669 FPSIINEGR 100.00 2e-06
31223520 FNIPSYDTQSNVVPK 100.00 4e-06
31223520 RGEVYFYFYQQLLAR 100.00 4e-06
31223520 RGEVYFYFYQQLLAR 100.00 4e-06
31223520 YDDNGIPLTLEDNWMK 100.00 4e-06
25860555 SIGHPYNFK 100.00 4e-06
26280517 SCDPEAPIMMYVSK 100.00 4e-06
24402669 SCTPNICVNDGICQEAR 100.00 4e-06
28467696 SDANADEAAEAVFSEIQR 100.00 4e-06
20822545 GTEGGFPFQLFVFVYPFDNK 100.00 5e-06
20822545 VHLNQGQFLYAFYIAVIQR 100.00 5e-06
31223520 GTEGGFPFQLFVFVYPFDNK 100.00 5e-06
31223520 GTEGGFPFQLFVFVYPFDNK 100.00 5e-06
31223520 GTEGGFPFQLFVFVYPFDNK 100.00 5e-06
31223520 GTEGGFPFQLFVFVYPFDNK 100.00 5e-06
31223520 IGKDYDIEMNMDNYTNKK 100.00 5e-06
31223520 IGKDYDIEMNMDNYTNKK 100.00 5e-06
20822545 RGEVYFYFYQQLLAR 100.00 5e-06
20822545 RGEVYFYFYQQLLAR 100.00 5e-06
20822545 RGEVYFYFYQQLLAR 100.00 5e-06
20822545 RGEVYFYFYQQLLAR 100.00 5e-06
20822545 RGEVYFYFYQQLLAR 100.00 5e-06
20822545 RGEVYFYFYQQLLAR 100.00 5e-06
20822545 RGEVYFYFYQQLLAR 100.00 5e-06
31223520 TFVQFLQKDHFEAFGQK 100.00 1e-05
31223520 TFVQFLQKDHFEAFGQK 100.00 1e-05
31223520 TFVQFLQKDHFEAFGQK 100.00 1e-05
31223520 TFVQFLQKDHFEAFGQK 100.00 1e-05
31223520 YDDNGIPLTLEDNWMK 100.00 1e-05
31223520 SDCHGFVVPAPYEVYPK 100.00 1e-05
25860555 ESSAEDTKSSNSNVQSDEKSASQSSSSR 100.00 1e-05
26280517 IGKDYDIEMNMDNYTNK 100.00 1e-05
24402669 IGKDYDIEMNMDNYTNK 100.00 1e-05
28467696 IGKDYDIEMNMDNYTNK 100.00 1e-05
20822545 TFVQFLQKDHFEAFGQK 100.00 1e-05
20822545 IYVTKMQDGLINPEAAAK 100.00 1e-05
20822545 IYVTKMQDGLINPEAAAK 100.00 1e-05
20822545 TFVQFLQKDHFEAFGQK 100.00 1e-05
20822545 VPNMYFKDIFIYHEGER 100.00 1e-05
20822545 VPNMYFKDIFIYHEGER 100.00 1e-05
20822545 IYVTKMQDGLINPEAAAK 100.00 1e-05
20822545 TFVQFLQKDHFEAFGQK 100.00 1e-05
31223520 DYDIEMNMDNYTNKK 100.00 2e-05
31223520 DYDIEMNMDNYTNKK 100.00 2e-05
31223520 DYDIEMNMDNYTNKK 100.00 2e-05
31223520 DYDIEMNMDNYTNKK 100.00 2e-05
31223520 DYDIEMNMDNYTNKK 100.00 2e-05
31223520 DYDIEMNMDNYTNKK 100.00 2e-05
31223520 RGEVYFYFYQQLLAR 100.00 4e-05
31223520 MRDEAIALFHLFYYAK 100.00 4e-05
31223520 RGEVYFYFYQQLLAR 100.00 4e-05
31223520 MRDEAIALFHLFYYAK 100.00 4e-05
26280517 IGINCPDMICIKK 100.00 4e-05
24402669 IGKDVVNNEDFR 100.00 4e-05
28467696 IGKDVVNNEDFR 100.00 4e-05
20822545 MRDEAIALFHLFYYAK 100.00 6e-05
20822545 IYVTKMQDGLINPEAAAK 100.00 6e-05
20822545 IYVTKMQDGLINPEAAAK 100.00 6e-05
31223520 IGKDYDIEMNMDNYTNK 100.00 6e-05
31223520 IGKDYDIEMNMDNYTNK 100.00 6e-05
31223520 IGKDYDIEMNMDNYTNK 100.00 6e-05
31223520 IGKDYDIEMNMDNYTNK 100.00 6e-05
20822545 IYVTKMQDGLINPEAAAK 100.00 7e-05
24402669 FNIPSYDTQSNVVPK 100.00 2e-04
20822545 IYVTKMQDGLINPEAAAK 100.00 3e-04
31223520 SDCHGFVVPAPYEVYPK 100.00 3e-04
31223520 SDCHGFVVPAPYEVYPK 100.00 3e-04
20822545 DIFIYHEGERFPYK 100.00 4e-04
20822545 DIFIYHEGERFPYK 100.00 4e-04
31223520 IPEFSWYSPIK 100.00 0.001
31223520 DEAIALFHLFYYAK 100.00 0.001
31223520 DEAIALFHLFYYAK 100.00 0.001
31223520 IPEFSWYSPIK 100.00 0.001
25860555 VVDASVMPR 100.00 0.001
26280517 FEEPKIDPIDEQAAPK 100.00 0.001
25044914 FNIPEQSVEIYAEK 100.00 0.001
24402669 FNIPSSVK 100.00 0.001
28467696 FNIPEQSVEIYAEK 100.00 0.001
25860555 YEISGVIIHK 100.00 0.001
26280517 VNYVWVICR 100.00 0.001
24402669 VPEVEAAIR 100.00 0.001
28467696 VPFCPMVGSEVYSTEIK 100.00 0.001
31223520 YGIHKENDYFVYK 100.00 0.002
31223520 DIFIYHEGERFPYK 100.00 0.002
31223520 YGIHKENDYFVYK 100.00 0.002
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号