Gene

KWMTBOMO01223

Pre Gene Modal

BGIBMGA009037

Annotation

argonaute_3_[Bombyx_mori]

Location

Bomo_Chr3(-):5528399-5531217      View in EpiBrowser

Full name

Piwi-like protein Ago3       + More
Piwi-like protein 1      

Location in the cell

Extracellular   Reliability : 3.534

CDS

ATGTCTGTGCTATCTTACAAGGCTGGCAGTTTTGTAGCATCCTATAATCAAAGCATGACGCTTTGGTATTCGAAAGTGATCTTCCAAGAGAAGGGTCAAGAAATAGTTGATGGCTTGAAATGTTGTCTCGTTGATGCGTTAACTCATTATTTGAGATCAAACGGACAGCTTCCGGACAGGATCATCATATACAGAGACGGTGTAGGCGACGGGCAGCTGAAGTTATTGCAGCAATACGAGATACCTCAAATGAAGATTTGCTTCACGATATTGGGATCGAATTACCAGCCTACCCTGACCTATGTTGTCGTACAAAAACGTATCAACACTAGGATCTTCCTGAAGTCGAGAGACGGCTACGACAATCCGAACCCCGGGACCGTGGTCGATCACTGTATAACGAGACGGGACTGGTACGATTTCCTGATCGTCTCGCAGAAAGTGACCCAGGGCACTGTCACCCCGACCCATTACGTGGTGGTCTACGACGACAGCGGGATCACCCCGGACCAGTGTCAGCGTTTGACGTACAAGATGTGTCACTTGTACTACAACTGGCCGGGGACCGTGCGCGTTCCGGCGCCCTGTCAGTATGCGCACAAACTCTCGTATCTAGTGGGACAGTGCGTGCACGCGCAGCCGTCTGACGTTTTAGTCGATAAGCTGTTCTTTTTGTAG

Protein

MSVLSYKAGSFVASYNQSMTLWYSKVIFQEKGQEIVDGLKCCLVDALTHYLRSNGQLPDRIIIYRDGVGDGQLKLLQQYEIPQMKICFTILGSNYQPTLTYVVVQKRINTRIFLKSRDGYDNPNPGTVVDHCITRRDWYDFLIVSQKVTQGTVTPTHYVVVYDDSGITPDQCQRLTYKMCHLYYNWPGTVRVPAPCQYAHKLSYLVGQCVHAQPSDVLVDKLFFL

Description

Endoribonuclease that plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity (PubMed:19460866). Plays an essential role in meiotic differentiation of spermatocytes, germ cell differentiation and in self-renewal of spermatogonial stem cells (PubMed:19460866, PubMed:25558067). Its presence in oocytes suggests that it may participate in similar functions during oogenesis in females (PubMed:18191035). Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons (PubMed:19460866, PubMed:25558067). Directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements (PubMed:19460866, PubMed:25558067). Strongly prefers a have adenine at position 10 of their guide (g10A preference) (PubMed:24757166, PubMed:25558067). Plays a key role in the piRNA amplification loop, also named ping-pong amplification cycle: antisense piRNA-bound Siwi and sense piRNA-bound Ago3 reciprocally cleave complementary transcripts, to couple the amplification of piRNAs with the repression of transposable elements (PubMed:25558067).
Endoribonuclease that plays a central role in postnatal germ cells by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Directly binds methylated piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Strongly prefers a uridine in the first position of their guide (g1U preference, also named 1U-bias). Not involved in the piRNA amplification loop, also named ping-pong amplification cycle. Acts as an endoribonuclease that cleaves transposon messenger RNAs. Besides their function in transposable elements repression, piRNAs are probably involved in other processes during meiosis such as translation regulation. Probable component of some RISC complex, which mediates RNA cleavage and translational silencing. Also plays a role in the formation of chromatoid bodies and is required for some miRNAs stability. Required to sequester RNF8 in the cytoplasm until late spermatogenesis; RNF8 being released upon ubiquitination and degradation of PIWIL1.
Isoform 3: May be a negative developmental regulator (PubMed:12037681, PubMed:16287078).

Cofactor

Mg(2+)

Subunit

Interacts (when symmetrically methylated) with Papi/TDRKH (PubMed:23970546). Interacts with Vasa.
Interacts (via Piwi domain) with DICER1, suggesting that it forms ribonucleoprotein RISC complexes; this interaction is regulated by HSP90AB1 activity. Interacts with MAEL, KIF17, PABPC1, PRMT5 and WDR77. Interacts (when methylated on arginine residues) with TDRD1, TDRKH/TDRD2, RNF17/TDRD4, TDRD6, TDRD7 and TDRD9. Interacts with CLOCK. Interacts with MOV10L1. Interacts with ANAPC10; interaction oly takes place following piRNA-binding. Interacts with RNF8; leading to sequester RNF8 in the cytoplasm. Interacts with TEX19 (By similarity).

Miscellaneous

The sequence shown here is derived from an EMBL/GenBank/DDBJ third party annotation (TPA) entry.

Similarity

Belongs to the argonaute family. Piwi subfamily.
Belongs to the argonaute family.

Keywords

Complete proteome   Cytoplasm   Developmental protein   Differentiation   Endonuclease   Hydrolase   Magnesium   Meiosis   Metal-binding   Methylation   Nuclease   Reference proteome   RNA-binding   RNA-mediated gene silencing   Spermatogenesis   3D-structure   Alternative splicing   Disease mutation   Polymorphism   Translation regulation   Ubl conjugation  

Feature

chain  Piwi-like protein Ago3
splice variant  In isoform 3.
sequence variant  Probable disease-associated mutation found in a patient with azoospermia; requires 2 nucleotide substitutions.

Uniprot

A9ZSZ2   A0A194QIA0   A0A0N1IAN2   A0A212EYG1   A0A2R3SZW5   A7LNN5   + More
A0A2A4IUY8   A0A2H1WWK2   A0A2J7QHM1   A0A0L8HBN2   D1LXB5   V3ZNA5   A0A067R2W4   M9SWK5   W4Y9C2   A0A140H127   A0A210Q0Y2   A0A2J7QHJ0   Q3ZUK2   A0A1B2INM3   T2M9F7   U5XHW4   T2HRQ9   M9T4E3   A0A1S3HC55   M7C721   F9W2Z9   A0A1A6FVQ9   A0A1W5RXT9   F7BJH1   F7BJH8   A0A1S3JM11   A0A2B4RHN2   A0A2W1BMN2   A0A2S1PRU3   A0A293MTE2   A0A1X7VQA2   A0A0A7E975   A0A1W1ELL3   A0A3M6TDL1   S4W5D9   A0A3B4F4M4   A7SQI3   R7T852   Q96J94-3   A0A3B4F4S5   A0A212D8Q6   A0A1L7NZM5   A0A2S1PRU2   A0A024RBS5   Q96J94   A0A226N1F3   G3RI55   A0A2R8ZHG2   H2Q773   A0A2R5L8D7   A0A1W1ELM4   M3XKI6   A0A2K5CU01   B0FLQ9   A0A2K5JMW7   F7G629   F6WCQ1   A0A226PZU4   A0A2K6JPH8   F6Y409   A0A2K6P951   A0A093HBQ4   H2NJ51   A0A2K6E924   A0A2K5Z5K0   A0A096N174   A0A2K5M4Z5   G8F4S6   E1AWN5   A0A1U7UQH2   H0V419   A0A091K3D4   G1RA00   A0A151NS62   A0A2B4SRI4   T2M7W7   A0A195DHR5   V8NXN3   A0A1B6LP60   H9GH46   A0A091MFV6   T2HRA5   A0A0D9S5H9   G5AWP4   H9GML7   R0L9M7   G3ICR8   M4IU22   A0A286RTI8   A0A2K6UPL2   A0A384ARC3   A0A091CXM4   A0A2K5S8N6   F6YFN1  

EC Number

3.1.26.-

Pubmed

18191035    19121390    19460866    24757166    23970546    25558067    + More
26354079    22118469    17698031    23254933    24845553    23777831    28812685    24065732    24367095    23624526    21545709    18464734    28756777    30382153    23792802    17615350    11154219    12037681    14702039    15489334    17544373    12906857    14749716    16287078    23436708    21193640    21465557    28552346    28034629    11181995    22398555    22722832    16136131    9215903    17431167    24621616    19892987    25362486    22002653    21993624    22293439    24297900    21881562    21993625    21804562    28783426    17495919   

EMBL

AB332312    AB372007    BABH01012993    KQ458756    KPJ05288.1    KQ460317    + More
KPJ16015.1    AGBW02011540    OWR46501.1    MG778697    AVP80830.1    EU045577    ABS53349.1    NWSH01006379    PCG63479.1    ODYU01011556    SOQ57367.1    NEVH01013973    PNF28066.1    KQ418598    KOF86592.1    GU076092    ACY92621.1    KB203566    ESO83925.1    KK853043    KDR12118.1    KC516709    AGI95996.1    AAGJ04172579    KT447256    AMN88362.1    NEDP02005287    OWF42401.1    PNF28067.1    AM076487    CAJ28986.1    KT598029    ANZ54961.1    HAAD01002308    CDG68540.1    KF411462    AGZ62175.1    AB840993    BAN82534.1    KC516710    AGI95997.1    KB514175    EMP40308.1    BK007975    DAA34898.1    LZPO01116974    OBS58036.1    KX216828    AQX83033.1    AAPN01152697    AAPN01152698    LSMT01000612    PFX15775.1    KZ150022    PZC74874.1    MF288050    AWH61367.1    GFWV01019048    MAA43776.1    KJ820744    AIY62327.1    LT674429    SIP62985.1    RCHS01003812    RMX39472.1    KF032644    AGO85969.1    DS469746    EDO34027.1    AMQN01016043    KB312483    ELT87139.1    AF264004    AF104260    AF387507    AK093133    BC028581    AB274731    MKHE01000005    OWK14572.1    LC194147    BAW35369.1    MF288049    AWH61366.1    CH471054    EAW98511.1    MCFN01000275    OXB61416.1    CABD030087598    AJFE02060708    AACZ04070178    AACZ04070179    AACZ04070180    AACZ04070181    NBAG03000260    PNI57209.1    GGLE01001645    MBY05771.1    LT674441    SIP62997.1    AFYH01006730    AFYH01006731    AFYH01006732    EU334659    ABY58155.1    JSUE03008236    AWGT02000001    OXB84992.1    KL205919    KFV76830.1    ABGA01210979    NDHI03003599    PNJ17167.1    AHZZ02003328    AQIA01013399    JH331040    EHH62290.1    HQ012500    CM001263    ADM25309.1    EHH21328.1    AAKN02057840    KK543301    KFP31525.1    ADFV01092537    AKHW03002185    KYO39583.1    LSMT01000032    PFX31729.1    KF411461    HAAD01001793    AGZ62174.1    CDG68025.1    KQ980824    KYN12440.1    AZIM01001592    ETE66337.1    GEBQ01014580    JAT25397.1    AAWZ02029889    KK824226    KFP71848.1    AB840994    BAN82535.1    AQIB01028922    AQIB01028923    AQIB01028924    AQIB01028925    AQIB01028926    AQIB01028927    AQIB01028928    JH167272    GEBF01002981    EHB01502.1    JAO00652.1    AAWZ02033214    KB742969    EOB02334.1    JH001951    EGV97144.1    JQ745644    AGA54129.1    MF683123    ASW22511.1    KN123762    KFO23477.1   

Proteomes

UP000005204    UP000053268    UP000053240    UP000007151    UP000218220    UP000235965    + More
UP000053454    UP000030746    UP000027135    UP000007110    UP000242188    UP000085678    UP000031443    UP000092124    UP000002279    UP000225706    UP000007879    UP000275408    UP000261460    UP000001593    UP000014760    UP000005640    UP000198323    UP000001519    UP000240080    UP000002277    UP000008672    UP000233020    UP000233080    UP000006718    UP000198419    UP000233180    UP000002281    UP000233200    UP000053584    UP000001595    UP000233120    UP000233140    UP000028761    UP000233060    UP000009130    UP000233100    UP000189704    UP000005447    UP000001073    UP000050525    UP000078492    UP000001646    UP000029965    UP000006813    UP000001075    UP000233220    UP000261681    UP000028990    UP000233040    UP000002280   

PRIDE

A9ZSZ2    A7LNN5    Q96J94    G3ICR8   

Pfam

PF02170   PAZ        + More
PF02171   Piwi
PF08712   Nfu_N
PF01106   NifU
PF08699   ArgoL1
PF16486   ArgoN
PF05831   GAGE
PF02148   zf-UBP
PF00443   UCH

Interpro

IPR012337   RNaseH-like_sf        + More
IPR003165   Piwi       
IPR003100   PAZ_dom       
IPR036397   RNaseH_sf       
IPR036085   PAZ_dom_sf       
IPR001075   NIF_FeS_clus_asmbl_NifU_C       
IPR014824   Nfu/NifU_N       
IPR034904   FSCA_dom_sf       
IPR036498   Nfu/NifU_N_sf       
IPR031326   PIWIL1       
IPR014811   ArgoL1       
IPR032474   Argonaute_N       
IPR031320   GAGE       
IPR038765   Papain-like_cys_pep_sf       
IPR001607   Znf_UBP       
IPR001394   Peptidase_C19_UCH       
IPR033809   USP39       
IPR013083   Znf_RING/FYVE/PHD       
IPR028889   USP_dom       

SUPFAM

SSF53098   SSF53098        + More
SSF101690   SSF101690       
SSF117916   SSF117916       
SSF110836   SSF110836       
SSF54001   SSF54001       

Gene 3D

3.30.420.10     3.30.1370.70     3.30.300.130     3.30.40.10    

CDD

cd02669  Peptidase_C19M

ProteinModelPortal

A9ZSZ2   A0A194QIA0   A0A0N1IAN2   A0A212EYG1   A0A2R3SZW5   A7LNN5   + More
A0A2A4IUY8   A0A2H1WWK2   A0A2J7QHM1   A0A0L8HBN2   D1LXB5   V3ZNA5   A0A067R2W4   M9SWK5   W4Y9C2   A0A140H127   A0A210Q0Y2   A0A2J7QHJ0   Q3ZUK2   A0A1B2INM3   T2M9F7   U5XHW4   T2HRQ9   M9T4E3   A0A1S3HC55   M7C721   F9W2Z9   A0A1A6FVQ9   A0A1W5RXT9   F7BJH1   F7BJH8   A0A1S3JM11   A0A2B4RHN2   A0A2W1BMN2   A0A2S1PRU3   A0A293MTE2   A0A1X7VQA2   A0A0A7E975   A0A1W1ELL3   A0A3M6TDL1   S4W5D9   A0A3B4F4M4   A7SQI3   R7T852   Q96J94-3   A0A3B4F4S5   A0A212D8Q6   A0A1L7NZM5   A0A2S1PRU2   A0A024RBS5   Q96J94   A0A226N1F3   G3RI55   A0A2R8ZHG2   H2Q773   A0A2R5L8D7   A0A1W1ELM4   M3XKI6   A0A2K5CU01   B0FLQ9   A0A2K5JMW7   F7G629   F6WCQ1   A0A226PZU4   A0A2K6JPH8   F6Y409   A0A2K6P951   A0A093HBQ4   H2NJ51   A0A2K6E924   A0A2K5Z5K0   A0A096N174   A0A2K5M4Z5   G8F4S6   E1AWN5   A0A1U7UQH2   H0V419   A0A091K3D4   G1RA00   A0A151NS62   A0A2B4SRI4   T2M7W7   A0A195DHR5   V8NXN3   A0A1B6LP60   H9GH46   A0A091MFV6   T2HRA5   A0A0D9S5H9   G5AWP4   H9GML7   R0L9M7   G3ICR8   M4IU22   A0A286RTI8   A0A2K6UPL2   A0A384ARC3   A0A091CXM4   A0A2K5S8N6   F6YFN1  

PDB

5GUH     E-value=8.4614e-51,     Score=503

KEGG

100125337    K02156 aubergine | (RefSeq) Ago3, BmAGO3, Piwi, Siwi2; argonaute 3

GO

GO:0051321   GO:0007275   GO:0005737   GO:0004519   GO:0046872   GO:0003723   GO:0030154   GO:0007283   GO:0031047   GO:0003676   GO:0016226   GO:0051536   GO:0005506   GO:0034584   GO:0007286   GO:0003729   GO:0033391   GO:0035093   GO:0006417   GO:1905538   GO:0140262   GO:0005634   GO:0004521   GO:0010529   GO:0043186   GO:0097433   GO:0019901   GO:0003727   GO:0034587   GO:0003743   GO:0016021   GO:0004497   GO:0005507   GO:0006000   GO:0004553   GO:0006334   GO:0003779  

PANTHER

PTHR22891:SF46  

Subcellular location

Cytoplasm   Component of the meiotic nuage, also named P granule, a germ-cell-specific organelle required to repress transposon activity during meiosis.   With evidence from 8 publications.

Length:

225

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.09243

Exp number, first 60 AAs:

0.00703

Total prob of N-in:

0.04520

outside

1  -  225

 

 

Pi

257.528665

Theta

175.944899

Tajima's D

1.386452

CLR

0.014857

CSRT

0.759662016899155

Interpretation

Uncertain