SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01217
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.725
 

Sequence

CDS
ATGCGTCTGGTTCGTACGTTGGTCTTCTCTATCTTCCTGTACGGGGTGGAGACTTGGTGTCTCAGGAAAAAGGAACGCAAAAAGATTGAGGCGTTTGAAATGTATTGCTGGAGAAAGCTGCTACGCATTCCTTGGACAGCTATGAGAACCAATCCTCGAAGAGCTGAAGATCACCAAGCGCCTGCTGACTATGTGCCAGAAAGGATCCGGAGTTTCTTTGGGCACATAATGCGATCCTCATTGCACAGCCTGGAGAAACTCACAATTCTCGGACAAATGGAGGGGAAGCGCACTAGAGGAAGAGCGCCAGCTAGATGGATTGACCAACTCAAGGAGGTGACTGGAGGCCAGATATGGGGAGCGGTACATATGGCGCAGAACCGGACCGAGTGGAGAAGATTGACATACAGTCACGATCCTCAGCATTGA
Protein
MRLVRTLVFSIFLYGVETWCLRKKERKKIEAFEMYCWRKLLRIPWTAMRTNPRRAEDHQAPADYVPERIRSFFGHIMRSSLHSLEKLTILGQMEGKRTRGRAPARWIDQLKEVTGGQIWGAVHMAQNRTEWRRLTYSHDPQH

Summary

EMBL
KZ150203    PZC72267.1    GU815090    ADF18553.1    FJ265548    ADI61816.1    + More
FJ265546    ADI61814.1    ODYU01001007    SOQ36619.1    ODYU01003523    SOQ42419.1    FJ265547    ADI61815.1    FJ265560    ADI61828.1    FJ265552    ADI61820.1    FJ265557    ADI61825.1    ODYU01004401    SOQ44236.1    FJ265553    ADI61821.1    MRZV01000994    PIK41715.1    MRZV01001216    PIK39650.1    MRZV01000196    PIK55924.1    AHAT01022938    MRZV01001207    PIK39730.1    MRZV01002322    PIK33998.1    MRZV01000056    PIK60437.1    MRZV01000817    PIK43880.1    MRZV01000940    PIK42365.1    MRZV01000378    PIK51329.1    BART01031562    GAH15691.1    FJ265559    ADI61827.1    AAGJ04161766    AAGJ04055194    KL363256    KL367985    KFD50217.1    KFD59415.1    AHAT01009145    AHAT01015286    KK852482    KDR22935.1    KK852941    KDR13536.1    KK852811    KDR15914.1    ABLF02024992    ABLF02024994    ABLF02025002    ABLF02043975    KK852530    KDR21932.1    KK853131    KDR10935.1    AHAT01022314    GGMR01005851    MBY18470.1    KL363266    KL367526    KFD49675.1    KFD66333.1    ABLF02042206    KK853249    KDR09341.1    GDHC01017214    JAQ01415.1    GBRD01015972    GBRD01015971    GBRD01015970    JAG49854.1    AFYH01119920    KK852843    KDR15156.1    AJ132772    CAA10770.1    AHAT01017596    AHAT01012943    KZ149985    PZC75696.1    KK852779    KDR16678.1    GBBM01006298    JAC29120.1    ABLF02046942    ABLF02059971    KK852456    KDR23625.1    GDHC01004555    JAQ14074.1    NWSH01002736    PCG67606.1    ODYU01006805    SOQ48998.1    AHAT01017643    ABLF02031909    AAGJ04128321    ABLF02038495    GDRN01098129    JAI59014.1    GU815089    ADF18552.1    AHAT01025955    GGMS01001369    MBY70572.1    MRZV01000221    PIK55282.1    AHAT01013157    AHAT01013158    AAGJ04021158    BDSA01000081    GBE63537.1    ABLF02012409    ABLF02012412    GGMR01013640    MBY26259.1    AAGJ04122993    QIAP01000240    PYX61602.1    GGMS01004979    MBY74182.1    NWSH01000469    PCG76200.1    AMGL01091659    AMGL01091660    AMGL01091661    AMGL01091662    AMGL01091663    AMGL01091664    AMGL01091665    AMGL01091666    AMGL01091667    AMGL01091668    AAGJ04075245    GGMS01001437    MBY70640.1    GBHO01020011    GDHC01013600    JAG23593.1    JAQ05029.1    MRZV01001840    PIK35676.1    GGMR01009131    MBY21750.1    GGMR01016881    MBY29500.1    GGMS01006790    MBY75993.1    AGCU01064655    GGMR01018096    MBY30715.1    LK055282    CDR71995.1    NEVH01002574    PNF41923.1    KF881087    AIJ27486.1    KF881086    AIJ27485.1    AHAT01016497    MRZV01002544    PIK33458.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF03221   HTH_Tnp_Tc5
PF04218   CENP-B_N
PF05699   Dimer_Tnp_hAT
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR000477   RT_dom       
IPR005135   Endo/exonuclease/phosphatase       
IPR002138   Pept_C14_p10       
IPR006600   HTH_CenpB_DNA-bd_dom       
IPR007889   HTH_Psq       
IPR009057   Homeobox-like_sf       
IPR008906   HATC_C_dom       
SUPFAM
SSF56219   SSF56219        + More
SSF46689   SSF46689       
Gene 3D

Ontologies

Topology

SignalP
Position:   1 - 20,         Likelihood:  0.718273
 
 
Length:
142
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.931919999999998
Exp number, first 60 AAs:
0.93152
Total prob of N-in:
0.11262
outside
1  -  142
 
 

Population Genetic Test Statistics

Pi
359.450945
Theta
153.12033
Tajima's D
4.236395
CLR
0
CSRT
0.999600019999
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号