SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01196
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.659
 

Sequence

CDS
ATGCTGGGAGTATCCAACAGATCGAAGCGGTACTTCACGCCTGGACAAAGGCTTTTGCTTTATAAAGCACAAGTCCGGCCTCGAGTGGAGTACTGCTCCCATCTCTGGGCTGGGGCTCCCAAATACCAGCTTCTTCCATTGGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATTATCCCATTCTCACGGATCGTTTGGAACCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTGTTTTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCGGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGCTCATCCATACTACATGGAGCCACTGCGGTCATCCACAGTGCGTTTCCAGAGGTATTTTTGCCACGTACCATCCGGCTAA
Protein
MLGVSNRSKRYFTPGQRLLLYKAQVRPRVEYCSHLWAGAPKYQLLPLDSIQRRAVRIVDYPILTDRLEPLGLRRDFGSLCVLYRMFHGECSEELFEMIPASRFYHRTARHRSRAHPYYMEPLRSSTVRFQRYFCHVPSG

Summary

EMBL
AB126052    BAD86652.1    AY359886    AAQ57129.1    ODYU01007424    SOQ50185.1    + More
ODYU01002162    SOQ39302.1    FM995623    CAX36785.1    HAAD01001474    CDG67706.1    ODYU01000366    SOQ35027.1    AMCI01002135    EJX03495.1    ODYU01007423    SOQ50184.1    DPOC01000269    HCX22453.1    ODYU01004409    SOQ44252.1    GDRN01105059    JAI57791.1    ODYU01011959    SOQ58001.1    HAAD01005022    CDG71254.1    LWDP01000391    ORD92879.1    ODYU01006795    SOQ48973.1    GFAC01000919    JAT98269.1    KL206974    KFV87692.1    KL206020    KFV77928.1    KL205964    KFV77614.1    KL206569    KFV83968.1    KL205741    KFV73823.1    KL206232    KL206309    KL206999    KFV80275.1    KFV81186.1    KFV88582.1    KL206163    KFV79444.1    KL205979    KFV77661.1    KL206307    KFV81126.1    KL206894    KFV86733.1    KL206048    KFV78374.1    KL206330    KFV81283.1    KL206333    KFV81308.1    KL206236    KFV80393.1    KL206502    KFV82928.1    KL206805    KFV85878.1    KL206613    KFV84187.1    KL206225    KFV80018.1    KL205903    KFV76469.1    KL206341    KFV81395.1    KL206264    KFV80687.1    KFV81495.1    KL206638    KFV84453.1    KL206936    KFV87212.1    KL205765    KFV74228.1    KL206526    KFV83081.1    KL205812    KFV74894.1    KL205728    KL205733    KL205757    KL205924    KL206049    KL206274    KL206359    KL206368    KL206416    KL206438    KL206458    KL206553    KL206738    KL206902    KL206932    KL206979    KL206995    KL206996    KL207002    KFV73492.1    KFV73612.1    KFV74069.1    KFV77013.1    KFV78397.1    KFV80821.1    KFV81678.1    KFV81842.1    KFV82263.1    KFV82322.1    KFV82483.1    KFV83356.1    KFV85496.1    KFV86827.1    KFV87138.1    KFV87825.1    KFV88414.1    KFV88462.1    KFV88705.1    KL206410    KFV82084.1    KL206549    KFV83237.1    KL205926    KFV77067.1    KFV73601.1    KL206733    KFV85403.1    KL205665    KFV72673.1    KL205888    KFV76262.1    KL206562    KFV83655.1    KFV81119.1    KL206071    KFV78608.1    KFV83965.1    QRBI01000220    RMB92612.1    KL206129    KFV79085.1    KL206190    KFV79766.1    QRBI01000131    RMC03475.1    MRZV01001153    PIK40187.1    KL206600    KFV84076.1    KL207003    KFV88757.1    KL206694    KFV84978.1    KL206630    KFV84296.1    KL206188    KFV79735.1    QRBI01000111    RMC10945.1    KL206273    KFV80807.1    QRBI01000093    RMC21953.1    QRBI01000126    RMC04361.1    KL206086    KFV78804.1    KFV88760.1    QRBI01000106    RMC12940.1    KL205829    KFV75232.1    KL205810    KFV74798.1    KL206513    KFV82948.1    KL206811    KFV86001.1    KL206812    KFV86049.1    KFV81420.1    KL205877    KFV75915.1    RMC21288.1    KL206301    KFV80966.1    KFV76460.1    KL206514    KFV82949.1    KL205740    KFV73754.1    KL206036    KFV78283.1    KL217824    KFO99526.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF08159   NUC153
PF02182   SAD_SRA
PF00097   zf-C3HC4
PF16030   GD_N
PF13716   CRAL_TRIO_2
PF00616   RasGAP
PF00881   Nitroreductase
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR013083   Znf_RING/FYVE/PHD       
IPR036987   SRA-YDG_sf       
IPR018957   Znf_C3HC4_RING-type       
IPR015947   PUA-like_sf       
IPR017907   Znf_RING_CS       
IPR001841   Znf_RING       
IPR003105   SRA_YDG       
IPR031986   GD_N       
IPR008936   Rho_GTPase_activation_prot       
IPR036865   CRAL-TRIO_dom_sf       
IPR039360   Ras_GTPase       
IPR001936   RasGAP_dom       
IPR011993   PH-like_dom_sf       
IPR023152   RasGAP_CS       
IPR001251   CRAL-TRIO_dom       
IPR029479   Nitroreductase       
IPR000415   Nitroreductase-like       
SUPFAM
SSF56219   SSF56219        + More
SSF50978   SSF50978       
SSF88697   SSF88697       
SSF48350   SSF48350       
SSF55469   SSF55469       

Ontologies

Topology

Subcellular location
Nucleus  
Length:
139
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.000690000000000001
Exp number, first 60 AAs:
0.0002
Total prob of N-in:
0.30489
outside
1  -  139
 
 

Population Genetic Test Statistics

Pi
31.558901
Theta
28.821086
Tajima's D
0.573091
CLR
1.045134
CSRT
0.549772511374431
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号