SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01159
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.466
 

Sequence

CDS
ATGTCATGGTCCAGACGGCTGGCCGATCCTTCGGCTGGTCGTAGGACCGTCGAGGCGATTCGCCCGGTTCTTGTGAATTGGGTGAATCGTGACAGAGGACGCCTCACTTTCCGGCTCACGCAGGTGCTCACTGGGCATGGTTGCTTCGGTGAGTTCCTGCACCGGATCGGAGCCGAGCCGACGGCAGAGTGCCACCATTGTGGTTGCGGCTTGGACACGGCGGAGCACACGCTCGTCGCCTGCCCCGCATGGGAGGGGTGGCACCGTGTCCTCGTCGCAAAAATAGGAAACGACTTGTCGTTGCCGAGTGTTGTGGCATCGATGCTCGGCGACGACGAGTCGTGGAAGGCGATGCTCGACTTCTGCGAGTGCACCATCTCGCAGAAGGAGGCGGCGGGGCGCGTGAGAGACACGCAAGCCCGCCGCCGTCGAGCGGGGGCCAGGGAGGCGGATCTCGCCCAAGCCCTGGCCCTCTAA
Protein
MSWSRRLADPSAGRRTVEAIRPVLVNWVNRDRGRLTFRLTQVLTGHGCFGEFLHRIGAEPTAECHHCGCGLDTAEHTLVACPAWEGWHRVLVAKIGNDLSLPSVVASMLGDDESWKAMLDFCECTISQKEAAGRVRDTQARRRRAGAREADLAQALAL

Summary

Cofactor
FAD
Similarity
Belongs to the GMC oxidoreductase family.
EMBL
AB126050    BAD86650.1    AB090825    BAC57926.1    LBMM01009501    KMQ88083.1    + More
LBMM01005707    KMQ91279.1    LBMM01016102    KMQ84557.1    KZ149922    PZC77701.1    QOIP01000014    RLU15083.1    LBMM01012957    LBMM01012956    KMQ85900.1    KMQ85901.1    KZ149950    PZC76665.1    QOIP01000009    RLU18544.1    LBMM01006538    KMQ90523.1    KZ149896    PZC78733.1    AB078935    BAC06462.1    ODYU01003322    SOQ41921.1    KZ150386    PZC71062.1    QOIP01000004    RLU23632.1    QOIP01000060    RLU14687.1    KZ149918    PZC77857.1    KZ150308    PZC71477.1    AB078930    BAC06454.1    AB078931    BAC06456.1    ODYU01007528    SOQ50378.1    LBMM01003001    KMQ94089.1    AB078929    BAC06452.1    LBMM01012027    KMQ86470.1    PZC77700.1    LBMM01003679    KMQ93242.1    LBMM01006022    KMQ91008.1    LBMM01006909    KMQ90209.1    ODYU01006757    SOQ48893.1    LBMM01008861    KMQ88580.1    D85594    BAA19776.1    LBMM01009494    KMQ88097.1    GL450953    EFN80213.1    LBMM01001564    KMQ96079.1    ODYU01009945    SOQ54696.1    ODYU01005282    SOQ45985.1    LBMM01005733    KMQ91252.1    LBMM01006954    KMQ90166.1    ODYU01006342    SOQ48109.1    QOIP01000002    RLU25407.1    ODYU01004308    SOQ44039.1    LBMM01024024    KMQ82631.1    LBMM01006996    KMQ90129.1    LBMM01012797    KMQ85990.1    ABLF02006132    LBMM01008682    KMQ88705.1    LBMM01006657    KMQ90417.1    LBMM01004272    KMQ92618.1    QOIP01000012    RLU16027.1    QOIP01000013    RLU15211.1    QOIP01000007    RLU20280.1    ODYU01005115    SOQ45661.1    ODYU01008140    SOQ51495.1    ODYU01004693    SOQ44845.1    QOIP01000031    RLU14697.1    LBMM01003452    KMQ93523.1    GGMR01011974    MBY24593.1    LBMM01005634    KMQ91349.1    LBMM01006671    KMQ90407.1    LBMM01006662    KMQ90413.1    QOIP01000003    RLU25053.1    LBMM01019838    KMQ83439.1    LBMM01019839    KMQ83438.1    GGMR01010769    MBY23388.1    QOIP01000010    RLU18098.1    ABLF02026677    ABLF02032994    ABLF02059021    ABLF02064578    LBMM01004906    KMQ92001.1    LBMM01004505    KMQ92346.1    LBMM01006534    KMQ90528.1    ABLF02017307    GEHC01001045    JAV46600.1    GFXV01002090    MBW13895.1    LBMM01006640    KMQ90440.1    LBMM01015657    KMQ84725.1    LBMM01002052    KMQ95336.1    LBMM01015018    KMQ84954.1    LBMM01002480    KMQ94776.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF01553   Acyltransferase
PF03372   Exo_endo_phos
PF00732   GMC_oxred_N
PF00650   CRAL_TRIO
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002123   Plipid/glycerol_acylTrfase       
IPR036188   FAD/NAD-bd_sf       
IPR012132   GMC_OxRdtase       
IPR000172   GMC_OxRdtase_N       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR012337   RNaseH-like_sf       
IPR001251   CRAL-TRIO_dom       
IPR036865   CRAL-TRIO_dom_sf       
IPR036273   CRAL/TRIO_N_dom_sf       
IPR006759   Glyco_transf_54       
SUPFAM
SSF56219   SSF56219        + More
SSF51905   SSF51905       
SSF57756   SSF57756       
SSF53098   SSF53098       
SSF52087   SSF52087       
SSF46938   SSF46938       
Gene 3D

Ontologies

Topology

Length:
158
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00566
Exp number, first 60 AAs:
0.00418
Total prob of N-in:
0.14647
outside
1  -  158
 
 

Population Genetic Test Statistics

Pi
32.528918
Theta
24.662235
Tajima's D
0.887537
CLR
8.862084
CSRT
0.633468326583671
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号