SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO01013
Annotation
TRAS3_protein_[Operophtera_brumata]
Location in the cell
Mitochondrial   Reliability : 2.213 Nuclear   Reliability : 1.742
 

Sequence

CDS
ATGAGTCATCCCGAGGGTCATGGACCAAAAACCACAGCCAGAGCTTCCACAGTCTCTCCTAAACCCAAACCGAAACAAGGCGACGCGAAAAAGTTTTCGGTGCCCCCCCAAACGATTTCGGTTAGGAGGAGCATCGGGGAATGGGAGAAGGCTTCATATACATGCAAATTGGACGAAGCAACAGCATGCGCGGGCAGAGCAAAACAACAGCTCAACGCCGCACGCAACTTGAAAGGGGAGTTAAAAATTGAAGCCTTTAAAATGCTGGATAGGTTACTCGAAATTGTGAAAAAGTTGGAAATGCCCTCGAAAACAAAGGTAGAGAAGGAGGTCATGAAGCAGATGTACCGCGAAAATAGCAAGACAGAAATGGGCACGAGCAACCTGAAAAATATTATTGAGGAGCATAGTAAGGTTTTGGGAGAGACTGTGAAAGAAATGGACCGACTACGCACGGTTATTAGGAGACACGAGGAGAAAATGGATGACACGGCACAAAACGCCGAAAAACGAGATGGGGGACATAGCGGTGGAGAGTTTCTGGCGGAAATCCGTGAGCTCAAGCGACTCACACAAGAGACCCGGGTACGGACCGACGAGGCGCAGGGGGTAATTCCCTCGTACGCGGAGGTCCTGTCTCGGCCACCAGCCGCTAGAGTGGACAAGCCGAAGTTCTCCGTCATCGTGGGTTCAAAAAACGTCATCGATACTAGTGCTGATGTCATAGAAAAGCTGAGAGGGGCGTTAGATGCACGGCGCAGCGGTCTAAAGATAGAGCGTCTCCGTAGGGTACGCGATGCGAAGGTGGTTTTGAGCTGCGCGAGTAAAGAGGAGATGGAAAAGTTGTCCGAGCAGCTAAAGAACGATAAGAACCTTACTGCCGAGGATGGCTGA
Protein
MSHPEGHGPKTTARASTVSPKPKPKQGDAKKFSVPPQTISVRRSIGEWEKASYTCKLDEATACAGRAKQQLNAARNLKGELKIEAFKMLDRLLEIVKKLEMPSKTKVEKEVMKQMYRENSKTEMGTSNLKNIIEEHSKVLGETVKEMDRLRTVIRRHEEKMDDTAQNAEKRDGGHSGGEFLAEIRELKRLTQETRVRTDEAQGVIPSYAEVLSRPPAARVDKPKFSVIVGSKNVIDTSADVIEKLRGALDARRSGLKIERLRRVRDAKVVLSCASKEEMEKLSEQLKNDKNLTAEDG

Summary

Pfam
PF14529   Exo_endo_phos_2        + More
PF00075   RNase_H
PF00078   RVT_1
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR012337   RNaseH-like_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR036397   RNaseH_sf       
IPR002156   RNaseH_domain       
SUPFAM
SSF56219   SSF56219        + More
SSF53098   SSF53098       
Gene 3D

Ontologies

Topology

Length:
297
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00868
outside
1  -  297
 
 

Population Genetic Test Statistics

Pi
4.490171
Theta
35.039906
Tajima's D
-1.626277
CLR
0
CSRT
0.0486975651217439
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号