SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00996
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.345 Nuclear   Reliability : 1.887
 

Sequence

CDS
ATGGAATGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCAATTCAAATTTTTAACATACTGAAAAATTTTAATATAACCAAAAGATTCGTTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAGTGGTCTCCCTCGGTCTGTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGGCGCGAATTCAAAGAAATCCCAAACAAGAGAGCTACAACAAACAAAATGATAAGGTGTACGCACACAGTAGTGAAGAAGCGAGCAACCGCGTTCCGCCTGTCCAACGAGGTCATTTTCCATCCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGCAGTTGTGTATCAAAATACAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATACCATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGCAGAGGACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCATGAAGACTGGCCCTCCTCCAGTCCAGATATGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MEWTLKEDRVAVIALHRCGYAPIQIFNILKNFNITKRFVYRTIKRYNEDSSVDDRSRSGLPRSVRTPAVIKAVKARIQRNPKQESYNKQNDKVYAHSSEEASNRVPPVQRGHFPSSLMVWLGVSYWGLTEVHFCEKGVKTNAVVYQNTVLTNLVEPVSHTMFNNRHWVFQQDSAPAHRAQRTQDWLAAREIDFIRHEDWPSSSPDMNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGHFE

Summary

Pfam
PF13358   DDE_3        + More
PF00292   PAX
Interpro
IPR036388   WH-like_DNA-bd_sf        + More
IPR009057   Homeobox-like_sf       
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
SUPFAM
SSF46689   SSF46689       
Gene 3D
PDB
5CR4     E-value=6.65657e-09,     Score=143

Ontologies

Topology

Length:
271
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.30413
Exp number, first 60 AAs:
1.22901
Total prob of N-in:
0.08515
outside
1  -  271
 
 

Population Genetic Test Statistics

Pi
117.828854
Theta
77.285453
Tajima's D
0.952494
CLR
0.002446
CSRT
0.650817459127044
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号