SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00949
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.534 Nuclear   Reliability : 1.537
 

Sequence

CDS
ATGTGTATTCTTCCATGCTTACTGTACGGGTGTCAAACTTGGGCGTTGACAGAAGAACTATCAAACAAATTAAAAATTTGTCAAAACGGAATAGAGGGAAGTACAATAGGCGTAAAAAGAAAAGACCGAATAAAACTAAAAGACATAAAGAGCAAGACAAACTTTAAGAACGCATACACAACTTACAAACAGCTAAAATGGCGATGGTCTGGACATATGATCAGAGAGAAAAAGGAGAAATGGACCAGTTTAATAACTGAATGGTATCCACGAGATGGTAAAAGGAATAGAGGTAGACAGACTAAAAGATGGGAGGACGACATTATAAAAATAGCTGGTACTACATGGACGCGTGCAGCAAAGGACAGGACACAGTGGAAATCTTTAGAGGAGGCCTTTGTCGAAGGACAAGCTGCGATACCACAACCACCGTTTGCCGATATTTAA
Protein
MCILPCLLYGCQTWALTEELSNKLKICQNGIEGSTIGVKRKDRIKLKDIKSKTNFKNAYTTYKQLKWRWSGHMIREKKEKWTSLITEWYPRDGKRNRGRQTKRWEDDIIKIAGTTWTRAAKDRTQWKSLEEAFVEGQAAIPQPPFADI

Summary

EMBL
ODYU01000693    SOQ35892.1    KZ150485    PZC70710.1    ODYU01006342    SOQ48110.1    + More
KZ149912    PZC78089.1    KZ150108    PZC73382.1    FJ265564    ADI61832.1    ODYU01004982    SOQ45402.1    FJ265561    ADI61829.1    EF113399    EF113400    ABO45233.1    EF113398    EF113401    ABO45231.1    FJ265563    ADI61831.1    EF113402    ABO45239.1    GEDV01010296    JAP78261.1    NWSH01004509    PCG65028.1    GBBI01004876    JAC13836.1    FJ265543    ADI61811.1    FJ265542    ADI61810.1    GBGD01002934    JAC85955.1    ODYU01009605    SOQ54153.1    FJ265550    ADI61818.1    GFTR01005437    JAW10989.1    FJ265549    ADI61817.1    BABH01035234    BABH01035235    FJ265544    ADI61812.1    FJ265562    ADI61830.1    FJ265545    ADI61813.1    GFTR01002495    JAW13931.1    ODYU01008431    SOQ52031.1    GEDV01000518    JAP88039.1    AAGJ04144474    GL440455    EFN65840.1    FJ265551    ADI61819.1    KZ149985    PZC75698.1    MRZV01001865    PIK35593.1    GBBI01004877    JAC13835.1    KZ150065    PZC74169.1    KZ150317    PZC71439.1    NWSH01003335    PCG66527.1    GBGD01000453    JAC88436.1    GDKW01001596    JAI54999.1    KZ150072    PZC74016.1    MRZV01002136    PIK34564.1    KZ149907    PZC78256.1    PYGN01000302    PSN48926.1    GBGD01000380    JAC88509.1    MRZV01000786    PIK44294.1    GECL01002465    JAP03659.1    JTDY01000331    KOB77663.1    AAGJ04012759    JARK01001338    EYC32701.1    EYC32700.1    JPKZ01002136    KHN78309.1    ODYU01008249    SOQ51673.1    MRZV01000899    PIK42833.1    MRZV01000618    PIK46838.1    JARK01000732    EYC35149.1    KZ150147    PZC72867.1    UYWY01020264    VDM41049.1    JARK01001565    EYB89683.1    JARK01001676    JARK01001446    JARK01001433    EYB83199.1    EYC01126.1    EYC02928.1    JARK01001337    EYC34625.1    GFAC01005640    JAT93548.1    QFQQ01000179    PZR20596.1    JARK01000189    EYC40932.1    GFAA01002978    JAU00457.1    KZ150308    PZC71479.1    MRZV01000215    PIK55436.1    JARK01001376    EYC14440.1    EYC14439.1    KZ149953    PZC76544.1    AAGJ04013248    JPKZ01000255    KHN88272.1    AAGJ04035986    JPKZ01003153    KHN73088.1    UYWY01019694    VDM38828.1    UYWY01019463    VDM37564.1    UZAG01000503    VDO08661.1    AAGJ04112537    JARK01001354    EYC21986.1    AAGJ04006812    AAGJ04005502    AAGJ04011852    AAGJ04112759    AAGJ04065374    JARK01001655    EYB84321.1    UYWY01001253    VDM26453.1    MRZV01000248    PIK54443.1    AAGJ04015353    JARK01001352    EYC22819.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

SignalP
Position:   1 - 15,         Likelihood:  0.597849
 
 
Length:
148
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00016
Exp number, first 60 AAs:
0.00016
Total prob of N-in:
0.02707
outside
1  -  148
 
 

Population Genetic Test Statistics

Pi
187.235554
Theta
78.634146
Tajima's D
4.321055
CLR
0
CSRT
0.999750012499375
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号