SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00926
Annotation
hypothetical_protein_M513_10814?_partial_[Trichuris_suis]
Location in the cell
Nuclear   Reliability : 3.92
 

Sequence

CDS
ATGCAACGCGTTGATAAAACGGACCCACCCCCCACAGAGCCATTATTTCCTCAACCTACCTCAGTATGCACAGTAGCCATAAAACTTCCTCCTTTCTGGCCTGATCGGCCTGCAATTTGGTTTGCTCAGGTAGAGGCACAGTTTTCGATTTCAGGCATCTCCGCTGACCTGACTAAATTTAACTACGTGATTGCTCAGTTAGATACCCGAGTTATTGGGGAGGTAGAGGACATTATTCTCCAACCACCACCTGAGGACAAATATGGTCGCCTCAAATCCGAGTTGATCCGTAGGTTGTCCACGTCTGAGGAGCAACGTGTCCGGCAACTTGTCAGTGATGTTGAGTTGGGTGACTGCCGTCCTTCGCAGTTTTTACGTCATCTTAGATCATTGGCAGGAAACACCCTCACTGATGAAAATTTGTTTCGCCAGCTATGGATGCGTCGCCTCCCACAACATCTCCAAGCAATTTTGGCCGCCCAATCAGAACTCTCGCTGGACAAAGTCGCTGAGCTAGCGGACAAAATTTTGGAAGTTTCGCCTAGTATGGTCGCACCTCATTCATCTGCTGTTTTCTCAGCAAGCACGTCTGCCGTCTCACCCCCTTCGTTAGAAGATATCACACGGCGTCTGGATGAGGTCACGCGTCAGCTTGCTGTGCTTACTGCAGAGCGCGGTAGAAATAGAACCCGGGATTTCTCAAACCAGCGACGACGCTCACAAACGCCTGGTAAGCTTCAAATGTGCTTTTACCATAGGAAATTTAATACTAAAGCTGTTAAGTGTATTCAACCATGTACCTGGACGCCGCCGCCACCTTCGGAAAACGACAAAAGCAGTCAATGA
Protein
MQRVDKTDPPPTEPLFPQPTSVCTVAIKLPPFWPDRPAIWFAQVEAQFSISGISADLTKFNYVIAQLDTRVIGEVEDIILQPPPEDKYGRLKSELIRRLSTSEEQRVRQLVSDVELGDCRPSQFLRHLRSLAGNTLTDENLFRQLWMRRLPQHLQAILAAQSELSLDKVAELADKILEVSPSMVAPHSSAVFSASTSAVSPPSLEDITRRLDEVTRQLAVLTAERGRNRTRDFSNQRRRSQTPGKLQMCFYHRKFNTKAVKCIQPCTWTPPPPSENDKSSQ

Summary

EMBL
KL363297    KFD48322.1    KL367555    KFD64488.1    KL367519    KFD66949.1    + More
LBMM01012479    KMQ86203.1    LBMM01013103    KMQ85816.1    KQ980726    KYN14011.1    KQ981018    KYN10257.1    LBMM01009142    KMQ88358.1    LBMM01012075    KMQ86422.1    GEZM01017686    JAV90494.1    NWSH01002598    PCG67884.1    NEVH01000707    PNF43124.1    KQ979048    KYN23218.1    KQ414987    KOC58988.1    LBMM01018089    KMQ83878.1    KQ981301    KYN43041.1    LHQN01021927    LHQN01025379    KOC58628.1    KOC58659.1    NEVH01013558    PNF28672.1    MRZV01001127    MRZV01000236    PIK40395.1    PIK54731.1    KK111495    EZA46390.1    KQ434816    KZC06854.1    NEVH01011195    PNF31836.1    GL447057    EFN86960.1    LBMM01012923    LBMM01012917    KMQ85926.1    KMQ85930.1    NEVH01003759    PNF40011.1    NEVH01024424    PNF17276.1    ACPB03037918    MRZV01000025    PIK61772.1    NEVH01014357    PNF27922.1    ODYU01011787    SOQ57731.1    NWSH01000267    PCG77880.1    KQ434784    KZC04993.1    GEZM01036621    JAV82564.1    NEVH01023981    PNF17578.1    NEVH01026435    PNF14140.1    GDQN01009305    JAT81749.1    GEDV01006140    JAP82417.1    KQ979024    KYN24351.1    NWSH01001575    PCG70822.1    LKEY01014428    KYN50445.1    KL367562    KFD64085.1    AAGJ04150373    GAMC01010905    JAB95650.1    KL363340    KFD47107.1    CH905996    KPU81830.1    JXUM01049417    KQ561603    KXJ78027.1    KQ414874    KOC59935.1    GFWV01009909    MAA34638.1    IAAA01053498    IAAA01053499    LAA11042.1    JXUM01031600    KQ560927    KXJ80313.1    GEDV01008183    JAP80374.1    JXUM01111110    KQ565471    KXJ70931.1    CH902629    KPU75574.1    MRZV01001674    PIK36447.1    GEZM01010484    JAV94030.1    KQ415240    KOC58703.1    QOIP01000006    RLU21744.1    LHQN01026442    KQ414593    KOC58672.1    KOC70162.1    KL367475    KFD72824.1    KQ421206    KOF78131.1    JXUM01107723    KQ565168    KXJ71261.1    KQ971745    KYB24749.1    GG695519    EFA13383.1    GFWV01009910    MAA34639.1    KQ979103    KYN22624.1    KQ434992    KZC13185.1    KQ971759    EFA12902.2    GFWV01018540    MAA43268.1    LBMM01007548    KMQ89630.1    KQ971355    EFA07205.2    KQ978645    KYN29457.1    KK107653    EZA48265.1    KL363241    KFD51246.1    KQ973343    KXZ75568.1    GBHO01008962    JAG34642.1    JXUM01142926    KQ569501    KXJ68606.1   
Pfam
PF10551   MULE        + More
PF00078   RVT_1
PF17921   Integrase_H2C2
PF17917   RT_RNaseH
PF00665   rve
PF17919   RT_RNaseH_2
Interpro
IPR021109   Peptidase_aspartic_dom_sf        + More
IPR018289   MULE_transposase_dom       
IPR000477   RT_dom       
IPR041588   Integrase_H2C2       
IPR001969   Aspartic_peptidase_AS       
IPR001995   Peptidase_A2_cat       
IPR041373   RT_RNaseH       
IPR036397   RNaseH_sf       
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
IPR009057   Homeobox-like_sf       
SUPFAM
SSF50630   SSF50630        + More
SSF53098   SSF53098       
SSF46689   SSF46689       
Gene 3D

Ontologies

Topology

Length:
281
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00715999999999999
Exp number, first 60 AAs:
0.00664
Total prob of N-in:
0.06841
outside
1  -  281
 
 

Population Genetic Test Statistics

Pi
75.858319
Theta
149.063404
Tajima's D
-1.09784
CLR
0
CSRT
0.121893905304735
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号