SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00810
Annotation
reverse_transcriptase_[Lasius_niger]
Location in the cell
Mitochondrial   Reliability : 1.711 Nuclear   Reliability : 1.722
 

Sequence

CDS
ATGAGGAAATCGCCAACCGACCCTTGGGCCAAGAGTACAACTGAAAAAGCTGAGCTATTTGCAAATTACTTGTATGAAATATTTACCCCTAACCTATCACCAATGGAGGACTATGAAAAAGAAGTTGATGTCATGATTAATAGTGACCAGCAGCTATCCCTGCCACTCAAATCCGTCACCCCCAGGGAACTTACGCAATGTATACAGTCTCTTATAAATAAAAAAGCTCCTGGTTTTGATTTAATAACTGGTGAGGTACTTAAAAAATTGCCCAAAAAAGTAATAATATTTTTAACAATGTTATTCAATGCTATCCTCAGAGTACATTATTACCCAAAACTCTGGCAAATAGCACAAGTCTGCATGGTTATAAAGCCTGGAAAACCAGCGTCAGATCCAAGTTCATATAGGCCCATAAGTCTTCTACCTGTGTTGTCTAAGGTGTTTGAAACGGTATTTCTAAAAAGACTGAAGCCGCTTCTTGACCAGGAAAAGATTATACCGGATCATCAGTTTGGATTTCGGGCGAAGCATTCTACTGTCGAACAAGTACACAGAGTAGTTCATAAAATTCGACAATCCTTAGAAAAGAAGGAATACTGTTCTGCGGCATTTATTGACATCAAGCAAGCTTTCGATAAAGTCTGGCATAAGGGATTACTATATAAATTGAAAACCCTCCTACCGAATTCTTTTTTCATGCTCCTGAGATCCTACTTAAAACACAGAAAATTCCAAGTCAAATTTGGAGAGGACTGTTCGAAACTGTATAATATTAACGCCTCCGTACCCCAGGGATCAGTGCTTGGTCCGGTCCTGTTTTCTATCTATACTGCAGACCTGCCTCAATCCCAAGATGTTGTAACTGCGACTTACGCTGACGATACAGCTTGTCTGGCAAGTGACATAGATCCACATAATGCATCATTACAACTACAAGTACAGCTTGACAAAGTAGATGCTTGGTTGCAGAGATGGCGATTAAAACCTAGTGTAACTAAGTCAACGCAGGTAACATTCACCCTCCGGAAAGGTATCTGTGGCCCTGTTTACATGGAAGGTAAAGCTTTACCAAATGCCGACTCTGCGAAATACTTGGGATTACACCTAGACAGAAGATTAACCTGGGCGAACCATATAAAAGCAAAAAAACGAGAAGCGAACTTGCAATTTCTCTCTTTGAATTGGTTACTGGGACGCCGGTCTCCACTGTCACTAAGTAACAAACTCCTGGTCTACAAAGCGATTATAAAACCTGTCTGGACTTATGGAATAGAACTGTGGGGTTCCGCTAGCAACTCGAATATCGAGATCTTACAGAGATTCCAGAACATTGCTCTTAGAACTATCTCAAACGCGCATTGGTTTGTAAGAAATAGTGAGATTCACGAATATTTAGAAATGCCGACTGTTCGAGAGGAAGTCAACAAGAACAGCAAGAGATATAAGGAAAGACTAAATGAGCACTCAAATGAATTGGCAAGGTGCCTGCTAGACACAACTGGAGATGTGAAACGTTTAAAAAGATGGCAAATTTTAGACTTAGACCAAAGATACTAA
Protein
MRKSPTDPWAKSTTEKAELFANYLYEIFTPNLSPMEDYEKEVDVMINSDQQLSLPLKSVTPRELTQCIQSLINKKAPGFDLITGEVLKKLPKKVIIFLTMLFNAILRVHYYPKLWQIAQVCMVIKPGKPASDPSSYRPISLLPVLSKVFETVFLKRLKPLLDQEKIIPDHQFGFRAKHSTVEQVHRVVHKIRQSLEKKEYCSAAFIDIKQAFDKVWHKGLLYKLKTLLPNSFFMLLRSYLKHRKFQVKFGEDCSKLYNINASVPQGSVLGPVLFSIYTADLPQSQDVVTATYADDTACLASDIDPHNASLQLQVQLDKVDAWLQRWRLKPSVTKSTQVTFTLRKGICGPVYMEGKALPNADSAKYLGLHLDRRLTWANHIKAKKREANLQFLSLNWLLGRRSPLSLSNKLLVYKAIIKPVWTYGIELWGSASNSNIEILQRFQNIALRTISNAHWFVRNSEIHEYLEMPTVREEVNKNSKRYKERLNEHSNELARCLLDTTGDVKRLKRWQILDLDQRY

Summary

EMBL
NWSH01000032    PCG80497.1    PCG80496.1    LBMM01014395    KMQ85192.1    NEVH01020963    + More
PNF20308.1    NEVH01006736    PNF36716.1    GEZM01038405    JAV81653.1    NEVH01016340    PNF25410.1    NEVH01021925    PNF19341.1    NEVH01007402    PNF35856.1    NEVH01015305    PNF27092.1    NWSH01007753    PCG62823.1    PYGN01000192    PSN51582.1    NEVH01020940    PNF20481.1    GEZM01097906    JAV54051.1    NEVH01016302    PNF25823.1    NEVH01007393    PNF35987.1    NEVH01007578    PNF35646.1    NEVH01012089    PNF30491.1    GEZM01053022    JAV74219.1    GFDF01007661    JAV06423.1    NEVH01006721    PNF37225.1    NEVH01008277    PNF34262.1    NEVH01001347    PNF42959.1    NEVH01023979    PNF17579.1    LBMM01012078    KMQ86419.1    NEVH01026386    PNF14434.1    ABLF02041861    GFTR01008261    JAW08165.1    NEVH01019963    PNF22185.1    LBMM01013518    KMQ85605.1    GEZM01101509    JAV52620.1    GGMR01003787    MBY16406.1    GEBQ01030670    JAT09307.1    GGMS01009480    MBY78683.1    NEVH01026106    PNF14658.1    KU543673    AMS38352.1    GBGD01000881    JAC88008.1    GBHO01021814    GBHO01010549    JAG21790.1    JAG33055.1    GBBI01001646    JAC17066.1    GBGD01000880    JAC88009.1    GGMS01004444    MBY73647.1    NEVH01005295    PNF38784.1    GBGD01000799    JAC88090.1    GBHO01010547    GBHO01010546    JAG33057.1    JAG33058.1    GFTR01008251    JAW08175.1    ABLF02023279    ABLF02041474    GGMR01006491    MBY19110.1    GEDC01000337    JAS36961.1    GFTR01008151    JAW08275.1    GBBI01001570    JAC17142.1    GEZM01101506    JAV52621.1    GFTR01007997    JAW08429.1    GGMR01010373    MBY22992.1    GBBI01003810    JAC14902.1    GFTR01008169    JAW08257.1    GBBI01001699    JAC17013.1    GFXV01007093    MBW18898.1    GFXV01003078    MBW14883.1    GAKP01017773    JAC41179.1    GGMR01012443    MBY25062.1    CP012527    ALC48130.1    GFTR01008257    JAW08169.1    GGMR01000226    MBY12845.1    GGMR01000857    MBY13476.1    GGMR01000676    MBY13295.1    GGMR01018428    MBY31047.1    GGMR01003864    MBY16483.1    ABLF02042106    GFXV01002840    MBW14645.1    GFTR01008256    JAW08170.1    LBMM01012041    KMQ86458.1    LBMM01010106    KMQ87671.1    AY508487    AAS13459.1    GFTR01008269    JAW08157.1    X17551    CAA35587.1    GBBI01001642    JAC17070.1    GEZM01084969    JAV60363.1    GGMR01016114    MBY28733.1    GBGD01000389    JAC88500.1    GFTR01008254    JAW08172.1    ABLF02036794    GECL01003538    JAP02586.1    GGMR01011511    MBY24130.1    ABLF02028354    ABLF02028357    ABLF02062343    GGMR01006408    MBY19027.1    AY047531    AAK77263.1    GGMS01000737    MBY69940.1    GGMR01000005    MBY12624.1    GGMR01012305    MBY24924.1    KU543685    AMS38375.1    GFXV01000908    MBW12713.1    ABLF02016613    GBBI01003747    JAC14965.1    GGMS01008766    MBY77969.1    GFXV01005866    MBW17671.1    GGMR01006148    MBY18767.1    GBXI01011604    JAD02688.1    GGMS01012005    MBY81208.1    ABLF02017668    ABLF02021394    ABLF02055728    GGMR01012676    MBY25295.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF07530   PRE_C2HC
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR006579   Pre_C2HC_dom       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
519
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3.35904000000001
Exp number, first 60 AAs:
0.00105
Total prob of N-in:
0.17634
outside
1  -  519
 
 

Population Genetic Test Statistics

Pi
168.486964
Theta
123.732333
Tajima's D
0.682273
CLR
137.44788
CSRT
0.56057197140143
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号