SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00697
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.025 Nuclear   Reliability : 2.451
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAAATCGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCAATTCAAATTTTGAACATACTGAAAAATTTGAATATAACCAAAAGATTCGTTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAGTGGTTGCCCTCGGTCTGTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGGCGCGAATTCAAAGAAATCCCAAACGTAAGCAGAAACTGTTGGCCCTTCAGATGGGGTTAAGCAGAACCACGGTGAAAAGGGTGTTAAATGAAAACTTAGGGCTTCGGGCATATCGAAGAAAAACAGGACATCGTTTGAATGCTCGTCTAATGGACCTGAGACTGAAGAGATGCCGCGCTTTTTTGAAGCGGTACGCGGGAAAAAAATATCGGGAAATTCTTTTTTCGGATGAAAAAAATTTTACCGTTGAAGAGAGCTACAACAAACAAAATGATATGGTGTACGCACACAATAGTGAAGAAGCGAGCAACCGTATTCCGCGTGTCCAACGAGGTCATTTTCCATCATCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGCAGTTGTGTATCAAAATACAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATACCATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGTCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGATTGGCCGCACAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MEWTLKENRVAVIALHRCGYAPIQILNILKNLNITKRFVYRTIKRYNEDSSVDDRSRSGCPRSVRTPAVIKAVKARIQRNPKRKQKLLALQMGLSRTTVKRVLNENLGLRAYRRKTGHRLNARLMDLRLKRCRAFLKRYAGKKYREILFSDEKNFTVEESYNKQNDMVYAHNSEEASNRIPRVQRGHFPSSLMVWLGVSYWGLTEVHFCEKGVKTNAVVYQNTVLTNLVEPVSHTMFNNRHWVFQQDSAPAHRAKSTQDWLAAREIDFIRHEDCPSSSPDLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPHRLKACIQNHGGHFE

Summary

EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB363006    AB363010    + More
AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    AB473770    BAH20555.1    U47917    AAB47739.1    JF779677    AEO90418.1    LNIX01000030    OXA41211.1    UYSL01019905    VDL71189.1    CAVP010059404    CDL95787.1    JARK01001411    EYC06502.1    JARK01000255    EYC39473.1    JARK01001658    EYB84158.1    DS268612    EFO94085.1    JARK01000176    EYC41234.1    PDUG01000005    PIC23776.1    JARK01001337    EYC34439.1    DS268747    EFP00909.1    JARK01001345    EYC27589.1    PDUG01000006    PIC20538.1    UYSL01020440    VDL74616.1    JARK01000059    EYC44525.1    PDUG01000001    PIC51673.1    PIC28734.1    UZAH01029309    VDP05368.1    JOJR01000583    RCN36166.1    DS268508    EFO83264.1    JOJR01000015    RCN51257.1    DS268421    EFO88618.1    KX931010    APL98300.1    DS268492    EFP11689.1    PDUG01000012    PIC13506.1    DS268673    EFO98001.1    DS268466    EFP06959.1    DS268525    EFO85497.1    PIC29926.1    UZAH01027257    VDO90094.1    PDUG01000004    PIC32571.1    JARK01001601    EYB87313.1    DS268679    EFO98285.1    KN728607    KIH63514.1    DS268428    EFO94379.1    DS268545    EFO88382.1    PIC32570.1    UYSL01019770    VDL69590.1    HE601047    HE600964    CAS00660.1    CAS01013.1    HE601437    CAR99651.1    HE601507    CAR99239.1    PIC53815.1    DS268606    EFO93488.1    DS268565    EFO90304.1    DS268539    EFO88027.1    LFYR01002220    KMZ56176.1    HE600938    CAR99786.1   
Pfam
PF13358   DDE_3        + More
PF00292   PAX
PF00250   Forkhead
PF10320   7TM_GPCR_Srsx
Interpro
IPR009057   Homeobox-like_sf        + More
IPR036388   WH-like_DNA-bd_sf       
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
IPR036390   WH_DNA-bd_sf       
IPR001766   Fork_head_dom       
IPR030456   TF_fork_head_CS_2       
IPR036906   ATPase_V1_fsu_sf       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR019424   7TM_GPCR_Srsx       
IPR000792   Tscrpt_reg_LuxR_C       
SUPFAM
SSF46689   SSF46689        + More
SSF46785   SSF46785       
Gene 3D
PDB
5HOO     E-value=1.45008e-12,     Score=176

Ontologies

Topology

Subcellular location
Nucleus  
Length:
346
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.60357
Exp number, first 60 AAs:
0.46671
Total prob of N-in:
0.05190
outside
1  -  346
 
 

Population Genetic Test Statistics

Pi
2.104585
Theta
20.787548
Tajima's D
-0.48533
CLR
0.088368
CSRT
0.248537573121344
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号