SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00645
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.204 Mitochondrial   Reliability : 1.551 Nuclear   Reliability : 1.279
 

Sequence

CDS
ATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCGGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAAGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCTGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MFNNRHWVFQQDSAPAHRAKSTQDWLAAREIDFIRHEDWPSSGPDLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWLRRLKACIQNHGGHFE

Summary

EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB473770    BAH20555.1    + More
AB363006    AB363010    AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    U47917    AAB47739.1    LNIX01000030    OXA41211.1    UYSL01022144    VDL79905.1    UYSL01002425    VDL65835.1    JF779677    AEO90418.1    PDUG01000005    PIC23776.1    DS268612    EFO94085.1    JOJR01000015    RCN51257.1    JOJR01000583    RCN36166.1    UYSL01020634    VDL75527.1    JARK01001601    EYB87313.1    PDUG01000006    PIC20538.1    JARK01001658    EYB84158.1    KN729202    KIH62598.1    CAVP010058755    CDL95145.1    UYSL01009772    VDL68385.1    UZAH01001595    VDO19836.1    PDUG01000001    PIC51673.1    DS268747    EFP00909.1    UZAH01031030    VDP13493.1    DS268433    EFO97645.1    DS268420    EFO87874.1    JARK01001471    EYB97976.1    UYSL01023059    VDL81638.1    UYSL01020631    VDL75518.1    UYSL01019905    VDL71189.1    KI662043    ETN73029.1    PIC29926.1    JARK01001337    EYC34439.1    DS268492    EFP11689.1    EFP11674.1    JARK01001411    EYC06502.1    UZAH01026445    VDO80847.1    UYSL01019810    VDL70150.1    JARK01001418    EYC05389.1    DS268508    EFO83264.1    DS268565    EFO90304.1    DS268428    EFO94379.1    DS268466    EFP06959.1    DS268606    EFO93488.1    DS268421    EFO88618.1    UYSL01019770    VDL69590.1    DS268673    EFO98001.1    JARK01000255    EYC39473.1    DS268539    EFO88027.1    PDUG01000012    PIC13506.1    DS268679    EFO98285.1    UYSL01021399    VDL78127.1    DS268525    EFO85497.1    UYSL01020109    VDL72812.1    PDUG01000004    PIC32571.1    KN726559    KIH67820.1    JARK01000059    EYC44525.1    UYSL01020934    VDL76658.1    KN769991    KIH46151.1    JARK01001350    EYC23962.1    KN728435    KIH63782.1    JARK01000176    EYC41234.1    UYSL01023743    VDL82626.1    DS268545    EFO88382.1    JARK01001345    EYC27589.1    HE601413    CAS00486.1    UZAH01000669    VDO19161.1    KN726483    KIH68032.1    CAVP010059404    CDL95787.1    KN727613    KIH65309.1    PIC28734.1   
Pfam
PF13358   DDE_3        + More
PF00292   PAX
PF10320   7TM_GPCR_Srsx
Interpro
IPR009057   Homeobox-like_sf        + More
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
IPR036388   WH-like_DNA-bd_sf       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR019424   7TM_GPCR_Srsx       
IPR036906   ATPase_V1_fsu_sf       
SUPFAM
SSF46689   SSF46689       
Gene 3D
PDB
5CR4     E-value=5.32702e-07,     Score=121

Ontologies

Topology

Length:
111
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.29137
outside
1  -  111
 
 

Population Genetic Test Statistics

Pi
1.621237
Theta
10.399877
Tajima's D
-2.48462
CLR
0
CSRT
0.000349982500874956
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号