SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00613
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.13 Nuclear   Reliability : 1.361
 

Sequence

CDS
ATGCTGCTTGCTATCAAAAAGCGCAAGATAGAGTATCTCGGCCACGTGCTCAGGAACGATCGATACATGCTGCTGCAGCTGATAATTATGGGCAAAGTGGACGGAAAGAGACGTGCTGGGCGAAGGAAAAAGTCATGGCTCCGGAATATCCGGGAGTGGACCGGTATTGCCTCCGTCGAACAGCTGTTCCGGCTGGCTGCTGACAGAAAGGAATACAGAAAGCTAACGGCCAACCTTCAGGATTGA
Protein
MLLAIKKRKIEYLGHVLRNDRYMLLQLIIMGKVDGKRRAGRRKKSWLRNIREWTGIASVEQLFRLAADRKEYRKLTANLQD

Summary

EMBL
GU815089    ADF18552.1    NWSH01002736    PCG67606.1    KQ460652    KPJ12975.1    + More
GAIX01012977    JAA79583.1    KQ459585    KPI98284.1    KQ459602    KPI93474.1    KQ977522    KYN02133.1    KQ459765    KPJ20087.1    GDHC01017214    JAQ01415.1    GBHO01041897    JAG01707.1    ODYU01000306    SOQ34818.1    LBMM01003995    KMQ92919.1    GBRD01005612    JAG60209.1    GGMS01008711    MBY77914.1    GBHO01028834    JAG14770.1    GGMS01000367    MBY69570.1    LBMM01001656    KMQ95932.1    GGMS01004979    MBY74182.1    GBHO01020011    GDHC01013600    JAG23593.1    JAQ05029.1    LADJ01023802    KPJ21112.1    LADJ01040095    KPJ21345.1    NWSH01001998    PCG69477.1    AAGJ04161766    BART01031562    GAH15691.1    AFYH01119920    GGMR01013640    MBY26259.1    GGMR01016842    MBY29461.1    ABLF02012409    ABLF02012412    LBMM01006413    KMQ90631.1    NWSH01000469    PCG76200.1    HACG01049256    CEK96121.1    GGMR01005851    MBY18470.1    MRZV01000221    PIK55282.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    KZ149912    PZC78062.1    GGMR01012724    MBY25343.1    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    AAGJ04075245    AAGJ04021158    HACG01049496    CEK96361.1    HACG01049494    HACG01049495    CEK96359.1    CEK96360.1    MRZV01001840    PIK35676.1    KZ150136    PZC72990.1    KZ150087    PZC73751.1    NEVH01025142    PNF15708.1    MRZV01002526    PIK33493.1    AAGJ04068581    HACG01049492    CEK96357.1    MRZV01000964    PIK42080.1    HACG01049254    CEK96119.1    MRZV01002544    PIK33458.1    GFAH01000222    JAV48167.1    FJ265559    ADI61827.1    MRZV01000940    PIK42365.1    HACG01049490    HACG01049491    CEK96355.1    CEK96356.1    FJ265546    ADI61814.1    MRZV01002322    PIK33998.1    HACG01049249    CEK96114.1    HACG01049255    CEK96120.1    MRZV01000739    PIK45030.1    HACG01049245    CEK96110.1    AHAT01022938    NEVH01018421    PNF23288.1    MRZV01000056    PIK60437.1    MRZV01000378    PIK51329.1    KZ149994    PZC75509.1    KZ150366    PZC71172.1    AAGJ04063504    KK852927    KDR13697.1    GU815090    ADF18553.1    ABLF02024992    ABLF02024994    ABLF02025002    ABLF02043975    AAGJ04118689    AAGJ04161747    GGMR01016881    MBY29500.1    ABLF02015324    KZ149985    PZC75696.1    PYGN01000123    PSN53532.1    PYGN01000382    PSN47273.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF03188   Cytochrom_B561
PF10613   Lig_chan-Glu_bd
PF00096   zf-C2H2
PF03221   HTH_Tnp_Tc5
PF04218   CENP-B_N
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR006593   Cyt_b561/ferric_Rdtase_TM       
IPR027124   Swc5/CFDP2       
IPR019594   Glu/Gly-bd       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR006600   HTH_CenpB_DNA-bd_dom       
IPR007889   HTH_Psq       
IPR009057   Homeobox-like_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF57667   SSF57667       
SSF46689   SSF46689       
Gene 3D

Ontologies

Topology

Length:
81
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01592
Exp number, first 60 AAs:
0.01206
Total prob of N-in:
0.48232
outside
1  -  81
 
 

Population Genetic Test Statistics

Pi
22.109187
Theta
21.541055
Tajima's D
0.080436
CLR
0
CSRT
0.39998000099995
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号