SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00611
Annotation
Uncharacterized_protein_OBRU01_09015?_partial_[Operophtera_brumata]
Location in the cell
Mitochondrial   Reliability : 1.477 Nuclear   Reliability : 1.908
 

Sequence

CDS
ATGACTGAGCAAAAGGAACTAATAAAGAAACGTAGCAGCATCAAAGGTCGATTAACAGCGTTCGCGAGTCATCTGAAAACAATAGATGAATCAACGATCACTGCCACAGAGGTCAGGGAGTTACAATTGCGCATTGTGGACACTATGCGAACTCGTGTAAGAAGTCAGGGTGTAAGGTTTGCAAACGTAAACACCACACACTCATACACGTAA
Protein
MTEQKELIKKRSSIKGRLTAFASHLKTIDESTITATEVRELQLRIVDTMRTRVRSQGVRFANVNTTHSYT

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
70
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00025
Exp number, first 60 AAs:
0.00025
Total prob of N-in:
0.61214
inside
1  -  70
 
 

Population Genetic Test Statistics

Pi
19.229131
Theta
21.736435
Tajima's D
-1.493534
CLR
0.013224
CSRT
0.0575471226438678
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号