SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00596
Pre Gene Modal
BGIBMGA012226
Annotation
PREDICTED:_succinate_dehydrogenase_[ubiquinone]_flavoprotein_subunit?_mitochondrial-like_isoform_X1_[Bombyx_mori]
Full name
Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial       + More
Succinate dehydrogenase (quinone)      
Location in the cell
Nuclear   Reliability : 3.575
 

Sequence

CDS
ATGCAATCGATTACTAATTACAGAATTAAGAATCCTACATATAGAAAGCGAAATATATGCGAGGCGTCATTGGATAATCTGTTTAAAATACGAGATGCCAACGGTACCATTCCGACAGCGGAACTAAGGAACGCCATGAGAAACACGATGCAAAGCAAGTGCGCTGTCTTCAGAGAGGCCAAACTACTGGAAGAAGCTAATCAGGAGATGCTGAAGTGGTATCAGTCATTTAAAGACCTGCGTGTCACGGATCGTCGTCTCAACTGGAACAGCGATCTTGTCGAGAGCTTGGAGCTGCAGAACATGCTGCAACTGGCCATCCAGCTTACGGCCAGCGCTCACAAAAGAACTGAGAGTAGGGGCGCTCATTTCAGAGACGATTACCCTCATAGATGTGACGAAATGGACTATTCCAAGCCAGTCGAAGGCCAGACAAAGAAACCTTTCGACCAGCACTGGAGGAAACACAGTTTAACGATGCTAGACCAGGCCACCGGAAAGGTGACTATAAGCTATCGTCCAGTCATCGATACAACATTGGACGATGAAGTGAAGACAATTCCGCCTGTCCCGAGAGTTTACTGA
Protein
MQSITNYRIKNPTYRKRNICEASLDNLFKIRDANGTIPTAELRNAMRNTMQSKCAVFREAKLLEEANQEMLKWYQSFKDLRVTDRRLNWNSDLVESLELQNMLQLAIQLTASAHKRTESRGAHFRDDYPHRCDEMDYSKPVEGQTKKPFDQHWRKHSLTMLDQATGKVTISYRPVIDTTLDDEVKTIPPVPRVY

Summary

Description
Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Catalytic Activity
a quinone + succinate = a quinol + fumarate
Cofactor
FAD
Similarity
Belongs to the FAD-dependent oxidoreductase 2 family. FRD/SDH subfamily.
EC Number
1.3.5.1
EMBL
BABH01017291    KQ459605    KPI92015.1    KQ460953    KPJ10276.1    KZ150069    + More
PZC74085.1    AGBW02013270    OWR43708.1    NWSH01001792    PCG70127.1    ODYU01007767    SOQ50820.1    GEBQ01012168    JAT27809.1    UYRT01005209    VDK38189.1    GECZ01020786    JAS48983.1    ATLV01016449    KE525091    KFB41348.1    ODYU01009071    SOQ53224.1    UYRR01034923    VDK62777.1    GAPW01000570    JAC13028.1    JXUM01099388    KQ564488    KXJ72205.1    CH477675    EAT37381.1    DS231921    EDS26512.1    GGFM01006662    MBW27413.1    ADMH02000002    ETN68137.1    GGFJ01003028    MBW52169.1    GFDL01002549    JAV32496.1    GEDC01003948    JAS33350.1    GGFK01002760    MBW36081.1    GFDL01002551    JAV32494.1    JI169558    AB071995    ADY43969.1    BAB84191.1    NNAY01003584    OXU19149.1    GFDL01002555    JAV32490.1    GFDL01002556    JAV32489.1    GFDF01001754    JAV12330.1    GDIP01249472    JAI73929.1    APCN01005154    AAAB01008849    EAA07202.4    AXCN02001756    GDIP01192768    JAJ30634.1    AXCM01000168    CVRI01000073    CRL07754.1    GGFK01002780    MBW36101.1    DS469623    EDO38587.1    GECZ01026919    JAS42850.1    GECZ01032216    GECZ01029733    JAS37553.1    JAS40036.1    KM275751    AIX97507.1    KM275721    AIX97477.1    KQ459989    KPJ18738.1    LJIJ01000544    ODM96389.1    CAQQ02375801    KC161216    AGJ76544.1    GALA01001749    JAA93103.1    AMQN01001266    KB300949    ELU06144.1    ABJB010427648    ABJB010458834    ABJB010601799    DS643501    EEC02042.1    KZ149894    PZC78885.1    GECZ01026678    JAS43091.1    GDIQ01196112    JAK55613.1    GDIQ01196111    JAK55614.1    AJWK01017478    AJWK01017479    AJWK01017480    AJWK01017481    AJWK01017482    AJWK01017483    AK131350    BAG54767.1    GDIQ01096237    JAL55489.1    CM002911    KMY95086.1    MTYJ01000013    OQV23244.1    EAAA01002902    GFDG01004340    JAV14459.1    CCAG010016893    NEVH01016943    PNF25088.1    CM000362    EDX07810.1    KA645063    AFP59692.1    KQ459591    KPI96963.1    GDIQ01177150    JAK74575.1    GDIQ01140423    JAL11303.1    JL641141    AEQ00923.1    GFJQ02007998    JAV98971.1    GDIQ01216851    JAK34874.1    JI166437    ADY41782.1    GDIQ01253143    JAJ98581.1    KB203275    ESO85297.1    CH902619    EDV35711.1    KPU75792.1    GDIQ01251837    JAJ99887.1    GECU01018272    GECU01002633    JAS89434.1    JAT05074.1    KQ971358    EFA09226.1    GDIQ01250389    JAK01336.1    GDIQ01175204    JAK76521.1    GDIP01253414    JAI69987.1    JPKZ01000439    KHN87313.1   
Pfam
PF02910   Succ_DH_flav_C        + More
PF00890   FAD_binding_2
Interpro
IPR027477   Succ_DH/fumarate_Rdtase_cat_sf        + More
IPR014006   Succ_Dhase_FrdA_Gneg       
IPR015939   Fum_Rdtase/Succ_DH_flav-like_C       
IPR003953   FAD-binding_2       
IPR003952   FRD_SDH_FAD_BS       
IPR037099   Fum_R/Succ_DH_flav-like_C_sf       
IPR036188   FAD/NAD-bd_sf       
IPR011281   Succ_DH_flav_su_fwd       
SUPFAM
SSF51905   SSF51905        + More
SSF56425   SSF56425       
SSF46977   SSF46977       
Gene 3D
PDB
5C3J     E-value=4.00664e-53,     Score=522

Ontologies

Topology

Subcellular location
Mitochondrion inner membrane  
Length:
194
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00038
Exp number, first 60 AAs:
0
Total prob of N-in:
0.39938
outside
1  -  194
 
 

Population Genetic Test Statistics

Pi
23.317126
Theta
25.448983
Tajima's D
0.010478
CLR
0.700412
CSRT
0.381630918454077
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号