SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00449
Pre Gene Modal
BGIBMGA012135
Annotation
PREDICTED:_uncharacterized_protein_LOC105842699_[Bombyx_mori]
Transcription factor
Location in the cell
Nuclear   Reliability : 3.828
 

Sequence

CDS
ATGTCCACTAATGAAGAATGGAGGGCTTTGTGTATTATTTCCATTAATATTGACGACAATGTGTCAAAATTTGCATGCGTTTGTAGTTTACATTTTAATCAAGATAACTATTTAACAGAAGCTAAGAAAAAGTTAAAACCACAAGCGGTTCCTTCAGTATTCCGTAAGATTGCTTTTGATGGAACACTATCAATATGCAACCCTTGCTGGCTGAGATTTTATCGCGCAGTGCAAGTCCGGCCAGTAGACGATCCATTACCTCAGCAAGTTCAAGAACCATTACCCCAGCAAGTACAAGAAGAGGAAGTCCAAGAAATAGTAGTTGACGTTCAACAACAACAAGACATAGGTCTTATGACTATTCCTGGATATTTGCGTGTATCTAATACTGCTCGACGCTGTGTTTTTCAAAACTGCAGAAACGTACCAGCAAATGCTGTGCCAAAATATGTCAGGTTACATTTTTTTCGTATTAATAAGCTATTCATACCAAAACTTGCTCGAGTTTGCCAACCCCATATGATAAACAATGAATGGGAAGATCTACTTAATGAGCAAATACCTCTTCATGAAAACTTTAATAGTGCTCATGTTCTCGATATTATCGAGCTGTATGAATGGAGATTGGAACGAGGAACTCAGTTGGACTTCGAAAATGTTGAGGAGATAGATGACAATGAACTACATTTTTATACGGGTATGGATAAAATTCAATTCAATAATATTTTGAATCAAACATCTTCTCTACGTGATAGAACCAACAGTTCTGCTACTGTTTTGGGACTGTATTTAGTTAAAATAAGAACAGGTGAACCAGACGAGCGTATAGCTTCTATGTTTAATATGTCGAGAAGAACATTGGAACGAAAACTAAAAATAGCTCGAGAATGTTTATCTGAAGAGTTTGTTCCCCACCATCTGGGTTTGGATCACATGACGAGAGAAGATGTAGTAGCTCGCAACTTAACCATCCCGAGTCATATTTTTGGAGGTAACCAGAATGAACCTGCGGCCATTCTTGTGTGTGATGGAACATACATATACGTGCAAAAAAGCTCCAACTTCCTTTTTCAGAGAAGAACGTAG
Protein
MSTNEEWRALCIISINIDDNVSKFACVCSLHFNQDNYLTEAKKKLKPQAVPSVFRKIAFDGTLSICNPCWLRFYRAVQVRPVDDPLPQQVQEPLPQQVQEEEVQEIVVDVQQQQDIGLMTIPGYLRVSNTARRCVFQNCRNVPANAVPKYVRLHFFRINKLFIPKLARVCQPHMINNEWEDLLNEQIPLHENFNSAHVLDIIELYEWRLERGTQLDFENVEEIDDNELHFYTGMDKIQFNNILNQTSSLRDRTNSSATVLGLYLVKIRTGEPDERIASMFNMSRRTLERKLKIARECLSEEFVPHHLGLDHMTREDVVARNLTIPSHIFGGNQNEPAAILVCDGTYIYVQKSSNFLFQRRT

Summary

Pfam
PF13613   HTH_Tnp_4        + More
PF13359   DDE_Tnp_4
Interpro
IPR027805   Transposase_HTH_dom        + More
IPR027806   HARBI1_dom       

Ontologies

Topology

Length:
361
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01994
Exp number, first 60 AAs:
0.0042
Total prob of N-in:
0.02873
outside
1  -  361
 
 

Population Genetic Test Statistics

Pi
5.106023
Theta
5.551953
Tajima's D
-1.30126
CLR
19.592352
CSRT
0.0823958802059897
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号