SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00446
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.867
 

Sequence

CDS
ATGGGTATCAACGAGAACAAAGATAATACTGCTATTGCCCAAGCGCAAGTTGTCACTGGACATCTCGATAATAACATCAACAATTTTGGACCGCTGCCCGAGGGCGAACGTCGGGGCACGTCTGTAGCTGGCCACGGGCGTGACAGCATGCTAGCCAGTGGCTCCCGGACCACCGGCTGTACAGGAGTCGGGGACGCGGGGGGTAGGAGAAAGTCCTCAAGAGCTACAGCCGAGGCGATAATTAGGAGTAGATCAGCAACGCCAGCTGAGGATGTTTCGCAGGAGACATACGTCACCCAACCTGCGACCACCAAAGCTGGTAAACCAAGAGTGCGCATGAAATGGAGTGAAGATATTAACCTATTTATCATGCGCACATATTTCTACATTACCAAACTAGAAACGGACAAGTCAATGTACTGCAAAAGACTTTATGAACGATTCCGACATCGGTACCCTAGTTTAGACGTATCGTCACAAAGAATAGCAGACCAAAGAAGAGTTACACTAAGAAATAGACTTCTATCAGAACAAACTATTGACAACATTAAAATATCAGTCGCAGAGCAACTTAAACAAGAAGAACAGGACTATTTCAATACATCTAGACATAATGTATCCACCACACAACAACCAACTATGCCAGTCATCTTTGAAAAAGATCCCGCAAACTCCGACTATTATTCAACATCAATCGATATGGTCACAAATCAACAACTTTCAACTACAATAAGACATCAATCATGTGAAGCTTCGACACAAACAAATACGCTCCCAGAGTGGACTACACTTTTACAATCTGCAGAACAAGATAAATCTCTCGAAACAGCTATCACTAACGAACTAGCACAAAAACTTAACACGCAGCTTGAAACAGCACTAATTCAATATTCAGGTACAGACCCTACAGCTCGTCCCAAACTACCTCGATTAAAAGAGAATAAAACTTTATACGACTTAGTTGCAGTTTTTAACAAAGAAATTCTCGGTAAACACTTCACGATTGAATCTGACATCTGTGACATACAGTCACTGGTCTACTGCAGTGCTTTGGTTATTTCTGAGCATTTAGGATATAAAATCAGAAATAATCTACTATCACCCGAAAACCGTACACCTAAATCGCGAAAACCCTGTTGGCAATTTAGAATCGAAAATGATATTAAGAGACTGCGAGCTGAAATAGGTAGATTAACACAATACATTAACAACCATAATAACAGGTCTGATCGATTAATTAAAGCAGTTGAACAAATTTTTAGGAACACAAGAATTCATTCATCATATGAGAATAATAATACCAGGCCAGAAGAATTTTTGGACACATTAAAACAGAAATTAGCACTTAAATCACAGAGACTAAGTAGATATTTAAAGGCCTTACAGCGGAAAGAAGGCAATAAATTATTTATCAATAATGAGAAAAGGTTTTATAAATTACTTAGAAATGAGAGTGTAACTAATAATCAAATGCCCCAACCAGAAGAACTCAAAAACTACTGGTCTGATATCTGGAAAAATCAAGGAAACCATAATGAACAAGCTGAATGGATTAGTAAGGAAGTAAATAAATGGGAAAACATTGAACCGATGGAATTTGTGGAGCTTACAGTAGATGACATACAGGAAGTAACACGAAAAATGAAGAACTGGAAAGCAGCAGGAGTAGATAGCGTACAGAACTTTTGGTATAAAAAATTTTTTATCCTACACGATATAATAGCAAAGACTATCACAGACCTAATCAAAGGACAACAGGAACTCCCTAAATTCATAACAGCAGGAATAACTTATATGCTCCCTAAGAGCGAGCGAAAGGTGGAAGAGGACTGA
Protein
MGINENKDNTAIAQAQVVTGHLDNNINNFGPLPEGERRGTSVAGHGRDSMLASGSRTTGCTGVGDAGGRRKSSRATAEAIIRSRSATPAEDVSQETYVTQPATTKAGKPRVRMKWSEDINLFIMRTYFYITKLETDKSMYCKRLYERFRHRYPSLDVSSQRIADQRRVTLRNRLLSEQTIDNIKISVAEQLKQEEQDYFNTSRHNVSTTQQPTMPVIFEKDPANSDYYSTSIDMVTNQQLSTTIRHQSCEASTQTNTLPEWTTLLQSAEQDKSLETAITNELAQKLNTQLETALIQYSGTDPTARPKLPRLKENKTLYDLVAVFNKEILGKHFTIESDICDIQSLVYCSALVISEHLGYKIRNNLLSPENRTPKSRKPCWQFRIENDIKRLRAEIGRLTQYINNHNNRSDRLIKAVEQIFRNTRIHSSYENNNTRPEEFLDTLKQKLALKSQRLSRYLKALQRKEGNKLFINNEKRFYKLLRNESVTNNQMPQPEELKNYWSDIWKNQGNHNEQAEWISKEVNKWENIEPMEFVELTVDDIQEVTRKMKNWKAAGVDSVQNFWYKKFFILHDIIAKTITDLIKGQQELPKFITAGITYMLPKSERKVEED

Summary

Pfam
PF00078   RVT_1
Interpro
IPR000477   RT_dom        + More
IPR001611   Leu-rich_rpt       

Ontologies

Topology

Length:
610
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00235
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00204
outside
1  -  610
 
 

Population Genetic Test Statistics

Pi
3.12417
Theta
2.865992
Tajima's D
-1.548385
CLR
0.020923
CSRT
0.0436478176091195
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号