SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00417
Pre Gene Modal
BGIBMGA000489
Annotation
PREDICTED:_V-type_proton_ATPase_116_kDa_subunit_a_isoform_1-like_[Bombyx_mori]
Full name
V-type proton ATPase subunit a      
Location in the cell
PlasmaMembrane   Reliability : 4.847
 

Sequence

CDS
ATGGAAATTAGGAAAGTGGCATTCTTAGCCGTCTGCCAGGGCGAAGAGCTTAGCACGAGAATGGAAAAAATATTTAGTGGCTTCCGGGTGAACTCATACCCGTGCCCGGAATCTGCTAAGGAGCGACTAGAAATGATAAGTCAGCTAGAAACGAGGATGAGCGATTTAGAAGAGATTTTGAGTAAATCAAAGTACATTCGCTGCAAAACCTTACGGACTGTCGGCAAGCAATGGCAGAACGGAATTGTACAAGTGAAAAAAGCCAAGGCGATTTATCATACCATGAACCTTTTCTCCTTGGACATTACAAAGAAATGTCTAATTGGCCAATGCTGGATACCGGAACGCGATCTCATGAGAGTTCAAGACATTTTAGTGGAATGCTCGGAAACGATCGGTACAAATGTGCCCTCATTTATATCTAAAACTACGTTTTCAATGTCGCCGCCCACGTTCAATCGTACGAACAAATACACGCACGGCTTTCAAGTTCTGATCAATGCTTACGGCGATTCTATGTACAGGGAACTGAATCCAGCTCTTTATACAATAATATCTTTCCCGTTTTTGTTTGCTTTGATGTTCGGTGATATGGGACACGCTTTAATATTATTGTCGTTTTCTACTTGGATGGTTAAAAACGAGGAAAAATTCATAGCCATGAAAAGTAGAAATGAGATTTGGAACATTATATTTGGAGGTCGCTATATCATTTTATTGATGGGCATGTTCAGTTTTTTTTCCGGTGTTGTGTACAACGATTGTTTCGGCAGGTCGATAGTACCAATGCCGTCTTATTGGGTGAATACCTTCTCTTCAGAAGCCCTAGCTAAACAAAGTGTCCTCAATTTAGACCCGAAAGGGAAAACGAGAAATCTTTATTTATTGGGCGTTGACCCTGTCTGGGGCGTCGCAAAGAATAACATAATATATGAAAATTCTATTAAAATGAAGTTTTCTATAATTGTCGGAGTCCTTCATATGATATTTGGTTTAAATTTGAGCGTTGTAAACCATTGGTACCTGAATCGCCGATACTTAATAGTTTTTCAATTTATACCTGAAATTGTATTTTTAACCTGCATTTTCATGTGGCTGGTACTGCTGATGTTTTTCAAATGGTTCATGTATAGTGGTAAAATAAGTAAGTACTGTTGA
Protein
MEIRKVAFLAVCQGEELSTRMEKIFSGFRVNSYPCPESAKERLEMISQLETRMSDLEEILSKSKYIRCKTLRTVGKQWQNGIVQVKKAKAIYHTMNLFSLDITKKCLIGQCWIPERDLMRVQDILVECSETIGTNVPSFISKTTFSMSPPTFNRTNKYTHGFQVLINAYGDSMYRELNPALYTIISFPFLFALMFGDMGHALILLSFSTWMVKNEEKFIAMKSRNEIWNIIFGGRYIILLMGMFSFFSGVVYNDCFGRSIVPMPSYWVNTFSSEALAKQSVLNLDPKGKTRNLYLLGVDPVWGVAKNNIIYENSIKMKFSIIVGVLHMIFGLNLSVVNHWYLNRRYLIVFQFIPEIVFLTCIFMWLVLLMFFKWFMYSGKISKYC

Summary

Description
Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes. Required for assembly and activity of the V-ATPase.
Similarity
Belongs to the V-ATPase 116 kDa subunit family.
EMBL
ODYU01004399    SOQ44233.1    NWSH01000875    PCG73765.1    ODYU01008382    SOQ51925.1    + More
KQ459605    KPI91919.1    BABH01010757    BABH01010758    BABH01010759    GGFK01001376    MBW34697.1    GGMS01015647    MBY84850.1    KQ461196    KPJ06379.1    KQ459220    KPJ02860.1    GGFK01001212    MBW34533.1    GGFK01001312    MBW34633.1    GEDC01030163    GEDC01027538    GEDC01018456    GEDC01015987    JAS07135.1    JAS09760.1    JAS18842.1    JAS21311.1    CH940652    EDW59356.1    KRF78813.1    CP012526    ALC46094.1    GGMR01014235    MBY26854.1    JXUM01123189    JXUM01123190    JXUM01123191    JXUM01123192    GAPW01000216    JAC13382.1    CH933806    EDW14441.1    KRG01017.1    CH916369    EDV93299.1    CH902617    EDV42677.1    KPU79847.1    AXCM01006747    DS231859    EDS39016.1    ADMH02001150    ETN63909.1    AXCN02000267    GGFM01000600    MBW21351.1    GGFM01000527    MBW21278.1    GGFJ01002077    MBW51218.1    CM000160    EDW95904.1    GAIX01004080    JAA88480.1    CH964232    EDW80572.1    GGMR01007929    MBY20548.1    CM000364    EDX12446.1    CM000070    EAL27684.1    CH478180    EAT33671.1    CH480820    EDW54647.1    AF132183    AE014297    AAD34771.1    AAF55552.2    GANO01000631    JAB59240.1    GGMS01000632    MBY69835.1    CH479179    EDW24803.1    GFDL01009700    JAV25345.1    KK854026    PTY09713.1    AAAB01008987    EAA43151.2    APCN01000888    AJ439060    CAD27758.1    GFXV01004235    MBW16040.1    OUUW01000013    SPP88009.1    GDAI01000904    JAI16699.1    GDQN01008557    GDQN01001991    JAT82497.1    JAT89063.1    ABLF02024323    GECZ01009916    JAS59853.1    GECZ01008283    JAS61486.1    KQ459984    KPJ18978.1    GECZ01015944    JAS53825.1    GECZ01015375    JAS54394.1    KU550964    ANW09710.1    GDHF01029529    GDHF01021876    JAI22785.1    JAI30438.1    GDHF01016550    JAI35764.1    GAKP01016222    JAC42730.1    KA646853    AFP61482.1    GDKW01000421    JAI56174.1    GFTR01008140    JAW08286.1    AGBW02012778    OWR44452.1    GECL01002185    JAP03939.1    GEBQ01024009    GEBQ01003411    JAT15968.1    JAT36566.1    GEBQ01009678    GEBQ01002003    JAT30299.1    JAT37974.1    GL763459    EFZ19682.1    AJVK01026954    KK852470    KDR23260.1    GBGD01000465    JAC88424.1    KQ971311    KYB29411.1    NEVH01014852    PNF27424.1    KYB29412.1    GAMC01006625    JAB99930.1    PNF27423.1    JR036125    AEY56937.1    UFQS01000635    UFQT01000635    SSX05612.1    SSX25971.1    GEBQ01012881    JAT27096.1    KYB29410.1    GEBQ01028484    JAT11493.1    GBHO01021481    GBHO01001930    JAG22123.1    JAG41674.1    EEZ99071.2    GBXI01008638    JAD05654.1    DS235848    EEB18611.1    SSX05611.1    SSX25970.1   
Pfam
PF01496   V_ATPase_I
Interpro
IPR026028   V-type_ATPase_116kDa_su_euka        + More
IPR002490   V-ATPase_116kDa_su       
PDB
6O7T     E-value=2.95134e-64,     Score=622

Ontologies

Topology

Length:
385
Number of predicted TMHs:
4
Exp number of AAs in TMHs:
90.86008
Exp number, first 60 AAs:
0
Total prob of N-in:
0.40731
inside
1  -  180
TMhelix
181  -  203
outside
204  -  230
TMhelix
231  -  253
inside
254  -  318
TMhelix
319  -  341
outside
342  -  355
TMhelix
356  -  378
inside
379  -  385
 
 

Population Genetic Test Statistics

Pi
19.249853
Theta
19.508986
Tajima's D
-0.55294
CLR
0.039323
CSRT
0.233738313084346
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号