SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00383
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.437
 

Sequence

CDS
ATGGACCGTGTTTGTGTGGCATTTTTCTCTACGGCGCAGAGACTTGGACCCTCAAGAAAGCCGACCGCCAACGGGATTCGTTGGACAGAACACAGAACCAACGAATCCATTCTTACCGAGCTCAAGATTCCAATGCACCTCCGCACTACATGCGCGCGGAGGAGTTTCGAGATCTTTGGACATATCGCCAGAAAGAGAGGTGACAATCTGGAAAAGCTGCTGGTAACAGGCAAGGCCGCGGAGAGTGCCACCTGTCGATGCCCATATCGTTGTTGGAGGCGTCCGTATCGGGTCGGGGTGCAGTTGAAGTACCTCGGCCTCATTCTGGACAGTCGTTGGACCTTCCGTGTTCACTTTCAGAACCTGGTCCCTCGTTTGTTGGGGGTGGCCGGCGTGTTAAGCCGGCTTCTTCCCAACATCGGGGGGCCTGACCAGGTGACGTGCCTTATACGAGGCGCCCGCGTGGGGCCAGTCACTGGCCGTGGGGGTAGCGAAGTTGCTGCAACGGCCGCAACGCACCATCGCGGTCAGGATCATCCGTGGTTATCGCACCATCTCTTTCGAGGCGGCGTGTGTACTGGGACGCCGCCTTGGATCCTGGAGGCGGAGGCGCCCGCCGCTGACTATCAGTGGCGGGCTAACCTTCGTGCCCGGGGCGTGGCGCGTCCCAGCCCCGGTGTGGTCAGAGCGCGGAGGGCCCAATCTCGGCGGTCCGTGCTGGAGTCATGGTCCAGGCGGCTGGTCGATCCTTCGGCTGGTCGTAGGACCGTCGAGGCGATTCGCCCGGTTCTTGTGAATTGGGTGAATCGTGACAGAGGACGCCTCACTTTCCGGCTCACGCAGGTACTCATTGGGCATGGTTGCACCGGATCGGAGCCGAGCCGACGGTAG
Protein
MDRVCVAFFSTAQRLGPSRKPTANGIRWTEHRTNESILTELKIPMHLRTTCARRSFEIFGHIARKRGDNLEKLLVTGKAAESATCRCPYRCWRRPYRVGVQLKYLGLILDSRWTFRVHFQNLVPRLLGVAGVLSRLLPNIGGPDQVTCLIRGARVGPVTGRGGSEVAATAATHHRGQDHPWLSHHLFRGGVCTGTPPWILEAEAPAADYQWRANLRARGVARPSPGVVRARRAQSRRSVLESWSRRLVDPSAGRRTVEAIRPVLVNWVNRDRGRLTFRLTQVLIGHGCTGSEPSRR

Summary

Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
296
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01479
Exp number, first 60 AAs:
0
Total prob of N-in:
0.02392
outside
1  -  296
 
 

Population Genetic Test Statistics

Pi
3.661758
Theta
19.889277
Tajima's D
-1.731447
CLR
0
CSRT
0.0338983050847458
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号