SGID The Silkworm Genome Information Database
Gene
KWMTBOMO00299
Pre Gene Modal
BGIBMGA000682
Annotation
PREDICTED:_ras-related_protein_Rab-21_[Amyelois_transitella]
Full name
Ras-related protein Rab-21      
Location in the cell
Nuclear   Reliability : 1.954
 

Sequence

CDS
ATGACTACTACGACTGGAGGTGCACGAAATTTTAAAGTAGTTCTTTTGGGTGACGGATGTGTCGGAAAAACTTCATTATTATTGCGTTACATTGAAGATAAATTTAACGAAAAGCATCTGACTACGCTTCAGGCCACATTCTTAAATAAAAGGTTGAATATTAATGGAAATCGTGTCAATCTTTCCATTTGGGATACAGCTGGCCAGGAGAAGTTTCATGCTCTGGGACCAATATACTACAGAAACTCTAATGGTGCGATTCTGGTTTACGATATTACTGATGAAGATTCATTTAGAAAGGTAAAAAATTGGGTGAAAGAATTGAAGAAAATGTTGGGATCAGATATTAATCTGGTAATTGCAGGAAATAAAATAGACCTTGAACATGAACGCACTGTTTCACTAGAAGAAGCAGAAAGCTATGCAAAATTAGTAGGAGCTAAACATTATTACACTTCAGCAAAATTAAACCAGGGTGTTGAAGAATTGTTTCTTGACTTGACTAGAGAAATGTTGGAAAGACAAGAACACAATACACAGACTGAAGTAAACAGAACATCACAAGTTGTAGTAGTCGATGATGAGGTACCTGTGCAATCAACCTGCTGTTCAGGACACAGGAGTTCCTAA
Protein
MTTTTGGARNFKVVLLGDGCVGKTSLLLRYIEDKFNEKHLTTLQATFLNKRLNINGNRVNLSIWDTAGQEKFHALGPIYYRNSNGAILVYDITDEDSFRKVKNWVKELKKMLGSDINLVIAGNKIDLEHERTVSLEEAESYAKLVGAKHYYTSAKLNQGVEELFLDLTREMLERQEHNTQTEVNRTSQVVVVDDEVPVQSTCCSGHRSS

Summary

Description
Regulates integrin internalization and recycling, but does not influence the traffic of endosomally translocated receptors in general (By similarity). As a result, may regulate cell adhesion and migration (By similarity). During the mitosis of adherent cells, controls the endosomal trafficking of integrins which is required for the successful completion of cytokinesis (PubMed:18804435). Involved in neurite growth (By similarity). Following SBF2/MTMT13-mediated activation in response to starvation-induced autophagy, binds to and regulates SNARE protein VAMP8 endolysosomal transport required for SNARE-mediated autophagosome-lysosome fusion (PubMed:25648148).
Subunit
Interacts with the cytoplasmic tail of integrins ITGA1, ITGA2, ITGA5, ITGA6, ITGA11 and ITGB1 (By similarity). Interacts with RABGEF1 (via VPS9 domain) (PubMed:17450153). Interacts with ANKRD27 (PubMed:16525121, PubMed:18477474). Interacts with VAMP7 (PubMed:25648148). Interacts (in GTP-bound form) with VAMP8 in response to starvation; the interaction probably regulates VAMP8 endolysosomal trafficking (PubMed:25648148).
Similarity
Belongs to the small GTPase superfamily. Rab family.
Keywords
3D-structure   Acetylation   Complete proteome   Cytoplasmic vesicle   Direct protein sequencing   Endoplasmic reticulum   Endosome   Golgi apparatus   GTP-binding   Lipoprotein   Membrane   Methylation   Nucleotide-binding   Prenylation   Protein transport   Reference proteome   Transport  
Feature
chain  Ras-related protein Rab-21
propeptide  Removed in mature form
EMBL
ODYU01007654    SOQ50618.1    AGBW02012593    OWR44777.1    JTDY01004809    KOB67724.1    + More
KK852542    KDR21730.1    NEVH01015312    PNF26974.1    KQ461108    KPJ09268.1    NEDP02004628    OWF45002.1    KQ459594    KPI96116.1    GL434640    EFN74693.1    LBMM01007086    KMQ90056.1    KQ978296    KYM95365.1    GDRN01035670    JAI67392.1    RCHS01000416    RMX58945.1    GEDC01025463    GEDC01022032    GEDC01000449    JAS11835.1    JAS15266.1    JAS36849.1    GECZ01009995    JAS59774.1    KQ981768    KYN36020.1    LSMT01000034    PFX31513.1    KQ976701    KYM77213.1    ADTU01003758    GL888331    EGI62695.1    KQ434938    KZC12110.1    GL771866    EFZ09181.1    KK107579    QOIP01000004    EZA48655.1    RLU23562.1    KQ980963    KYN11022.1    GL449444    EFN82666.1    DS469712    EDO34991.1    NNAY01000840    OXU26246.1    CABD030085385    CABD030085386    CABD030085387    GEBQ01025995    JAT13982.1    GBYB01000362    JAG70129.1    HAAD01000398    CDG66630.1    RJVU01017312    ROL52173.1    GFTR01003676    JAW12750.1    GBGD01002852    JAC86037.1    AQIA01011595    AQIA01011596    AQIA01011597    JH817881    EKC19528.1    GCES01026162    JAR60161.1    ABLF02029119    KQ971318    EFA00389.1    EF639001    ABR27886.1    HAAF01008698    CCP80522.1    GEMB01003017    JAS00187.1    JP016546    AES05144.1    JT416918    AHH42193.1    AK417285    BAN20500.1    AYCK01016789    HADW01013017    HADX01004132    SBP14417.1    HAED01012712    HAEE01001294    SBR21310.1    HADZ01004889    HAEA01012857    SBP68830.1    HAEB01009092    HAEC01012925    SBQ55619.1    HADY01002399    HAEJ01017582    SBS58039.1    AERX01019379    AERX01019380    AERX01019381    HAEI01002149    HAEH01010717    SBR79158.1    HAEF01008262    HAEG01008099    SBR80975.1    GGMR01004999    MBY17618.1    AJFE02118460    AJFE02118461    AACZ04072005    CAAE01007048    CAF89513.1    AAEX03007069    AMGL01039465    AHZZ02002464    NBAG03000393    PNI29901.1    ADFV01185858    ADFV01185859    GAMT01007263    GAMR01003862    GAMQ01004684    GAMP01008523    JAB04598.1    JAB30070.1    JAB37167.1    JAB44232.1    CH471054    EAW97271.1    AF091035    BC021901    BC092475    D42087    AKHW03000416    KYO47772.1    NDHI03003404    PNJ63576.1    HACG01034636    CEK81501.1    CABZ01072520    CABZ01072521    CABZ01085404    BC124522    BC165035    AAI24523.1    AAI65035.1    KK854042    PTY10118.1    JH881226    ELR55633.1   
Pfam
PF00071   Ras
Interpro
IPR041833   Rab21        + More
IPR005225   Small_GTP-bd_dom       
IPR001806   Small_GTPase       
IPR020849   Small_GTPase_Ras-type       
IPR027417   P-loop_NTPase       
SUPFAM
SSF52540   SSF52540       
PDB
1YZT     E-value=1.09668e-71,     Score=683

Ontologies

Topology

Subcellular location
Endoplasmic reticulum membrane   Colocalizes with ANKRD27 and VAMP7 in neurites (By similarity). In nonpolarized epithelial Caco-2 cells, found in the endoplasmic reticulum; in polarized cells, observed in vesicles in the apical cytoplasm (PubMed:10887961). During mitosis, in mid-telophase, localized in the ingressing cleavage furrow (PubMed:18804435). In late telophase, detected at the opposite poles of the daughter cells, in vesicles at the base of lamellipodia formed by the separating daughter cells (PubMed:18804435).   With evidence from 8 publications.
Golgi apparatus   Colocalizes with ANKRD27 and VAMP7 in neurites (By similarity). In nonpolarized epithelial Caco-2 cells, found in the endoplasmic reticulum; in polarized cells, observed in vesicles in the apical cytoplasm (PubMed:10887961). During mitosis, in mid-telophase, localized in the ingressing cleavage furrow (PubMed:18804435). In late telophase, detected at the opposite poles of the daughter cells, in vesicles at the base of lamellipodia formed by the separating daughter cells (PubMed:18804435).   With evidence from 8 publications.
trans-Golgi network   Colocalizes with ANKRD27 and VAMP7 in neurites (By similarity). In nonpolarized epithelial Caco-2 cells, found in the endoplasmic reticulum; in polarized cells, observed in vesicles in the apical cytoplasm (PubMed:10887961). During mitosis, in mid-telophase, localized in the ingressing cleavage furrow (PubMed:18804435). In late telophase, detected at the opposite poles of the daughter cells, in vesicles at the base of lamellipodia formed by the separating daughter cells (PubMed:18804435).   With evidence from 8 publications.
Golgi apparatus membrane   Colocalizes with ANKRD27 and VAMP7 in neurites (By similarity). In nonpolarized epithelial Caco-2 cells, found in the endoplasmic reticulum; in polarized cells, observed in vesicles in the apical cytoplasm (PubMed:10887961). During mitosis, in mid-telophase, localized in the ingressing cleavage furrow (PubMed:18804435). In late telophase, detected at the opposite poles of the daughter cells, in vesicles at the base of lamellipodia formed by the separating daughter cells (PubMed:18804435).   With evidence from 8 publications.
Early endosome membrane   Colocalizes with ANKRD27 and VAMP7 in neurites (By similarity). In nonpolarized epithelial Caco-2 cells, found in the endoplasmic reticulum; in polarized cells, observed in vesicles in the apical cytoplasm (PubMed:10887961). During mitosis, in mid-telophase, localized in the ingressing cleavage furrow (PubMed:18804435). In late telophase, detected at the opposite poles of the daughter cells, in vesicles at the base of lamellipodia formed by the separating daughter cells (PubMed:18804435).   With evidence from 8 publications.
Cytoplasmic vesicle membrane   Colocalizes with ANKRD27 and VAMP7 in neurites (By similarity). In nonpolarized epithelial Caco-2 cells, found in the endoplasmic reticulum; in polarized cells, observed in vesicles in the apical cytoplasm (PubMed:10887961). During mitosis, in mid-telophase, localized in the ingressing cleavage furrow (PubMed:18804435). In late telophase, detected at the opposite poles of the daughter cells, in vesicles at the base of lamellipodia formed by the separating daughter cells (PubMed:18804435).   With evidence from 8 publications.
Cleavage furrow   Colocalizes with ANKRD27 and VAMP7 in neurites (By similarity). In nonpolarized epithelial Caco-2 cells, found in the endoplasmic reticulum; in polarized cells, observed in vesicles in the apical cytoplasm (PubMed:10887961). During mitosis, in mid-telophase, localized in the ingressing cleavage furrow (PubMed:18804435). In late telophase, detected at the opposite poles of the daughter cells, in vesicles at the base of lamellipodia formed by the separating daughter cells (PubMed:18804435).   With evidence from 8 publications.
Length:
209
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.22849
Exp number, first 60 AAs:
0.2276
Total prob of N-in:
0.27900
outside
1  -  209
 
 

Population Genetic Test Statistics

Pi
0.490907
Theta
3.553106
Tajima's D
-2.264313
CLR
0
CSRT
0.00154992250387481
Interpretation
Uncertain
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号

渝公网安备 50010602502065号