SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00251
Annotation
PREDICTED:_uncharacterized_protein_LOC106713896?_partial_[Papilio_machaon]
Location in the cell
Cytoplasmic   Reliability : 1.224 Mitochondrial   Reliability : 1.266
 

Sequence

CDS
ATGCTTGCTAACACTGAGTACTTGCACAGACATAACCAAGCAGCCAGAATCCTCCACCACGAGCTCGCCCTTAAGTATGGCCTCATCGAACAGCGGCTACCGTATAATAAGTACCAGCCGGACGCCGTACTCGAAAACGACCGCGCCAAGCTCTACTGGGACCGACCCATCATCACGGACAGGACTATTCTTGCGAATAAGCTTGATATCGTGTTGATGGACCAGATGGAGTCTCGGGTATTTCTGGTGGATATCACCATCCCCTACGACGAGAACCTCGTGCGGGCCGAGGCAGATAAAAAGACCAAATATTTGGACATGTCGCACGAGGTGACCGACATGGCGAGGGTGGTATCTACAGAAATAATCCCGGTAGTTGTATTGGTGAATGGTTTGGTCCCTAAAAGCCTCTCAAAACATCTCGAGAGGCTTGGTTTCAAGAGAAAGTCGGTGGTGGCCCAAATGCAAAAAGCAGTCTTGCTGGACAATGCCCCTCTAGTTCGCCGGATTCTCGCCTAA
Protein
MLANTEYLHRHNQAARILHHELALKYGLIEQRLPYNKYQPDAVLENDRAKLYWDRPIITDRTILANKLDIVLMDQMESRVFLVDITIPYDENLVRAEADKKTKYLDMSHEVTDMARVVSTEIIPVVVLVNGLVPKSLSKHLERLGFKRKSVVAQMQKAVLLDNAPLVRRILA

Summary

Pfam
PF00078   RVT_1        + More
PF08205   C2-set_2
PF00096   zf-C2H2
Interpro
IPR000477   RT_dom        + More
IPR003598   Ig_sub2       
IPR036179   Ig-like_dom_sf       
IPR036116   FN3_sf       
IPR003961   FN3_dom       
IPR007110   Ig-like_dom       
IPR003599   Ig_sub       
IPR013783   Ig-like_fold       
IPR013162   CD80_C2-set       
IPR001611   Leu-rich_rpt       
IPR036236   Znf_C2H2_sf       
IPR013087   Znf_C2H2_type       
SUPFAM
SSF49265   SSF49265        + More
SSF48726   SSF48726       
SSF57667   SSF57667       
Gene 3D

Ontologies

Topology

Length:
172
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.333000000000001
Exp number, first 60 AAs:
0.00015
Total prob of N-in:
0.17137
outside
1  -  172
 
 

Population Genetic Test Statistics

Pi
5.211836
Theta
10.17313
Tajima's D
-1.418174
CLR
0.016064
CSRT
0.0694465276736163
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号