SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00159
Pre Gene Modal
BGIBMGA002151
Annotation
PREDICTED:_peptidylprolyl_isomerase_isoform_X1_[Bombyx_mori]
Full name
Peptidyl-prolyl cis-trans isomerase      
Location in the cell
Cytoplasmic   Reliability : 1.737 Mitochondrial   Reliability : 1.466
 

Sequence

CDS
ATGGGAAAAATTATGTTGGAAATGTATTGGAAACATGCACCTTTGACATGCAGAAATTTTATGGAATTGGTACGTCGAGGCTATTACAACAACACTAAATTTCATCGAGTTATTCGAGATTTCATGATTCAAGGTGGTGATCCAACTGGAACAGGAAAAGGAGGACAATCAATATATGGACCACACTTTAAAGATGAAATAACATCAGATTTAAAACATGCTGGTGCAGGTATATTGTCTATGGCTAATGCTGGTCCTAATACAAACGCATCACAGTTTTTTATAACATTGGCTCCAACACAATGGCTTGATGGTAAACATACGATTTTTGGCAGAGTGCAAAACGGAATGACTGTTGTCAAGAGAATTGGGTTAGTAGAGTGTGATAAAAATGATTGCCCCGTAGACGATGTTCGAATAGAAAGAGCCTACATTCCGAAATAG
Protein
MGKIMLEMYWKHAPLTCRNFMELVRRGYYNNTKFHRVIRDFMIQGGDPTGTGKGGQSIYGPHFKDEITSDLKHAGAGILSMANAGPNTNASQFFITLAPTQWLDGKHTIFGRVQNGMTVVKRIGLVECDKNDCPVDDVRIERAYIPK

Summary

Description
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Catalytic Activity
[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0)
Similarity
Belongs to the cyclophilin-type PPIase family.
EC Number
5.2.1.8
EMBL
BABH01016036    DQ443232    ABF51321.1    GAIX01011987    JAA80573.1    AGBW02008503    + More
OWR53196.1    NWSH01000159    PCG78942.1    KQ460152    KPJ17416.1    ODYU01007721    SOQ50753.1    JTDY01001227    KOB74475.1    GDKW01001268    JAI55327.1    GAHY01001212    JAA76298.1    GFTR01002866    JAW13560.1    GBBI01000580    JAC18132.1    JH816459    EKC31793.1    GBGD01003211    JAC85678.1    KK853182    KDR10176.1    GDHC01004808    JAQ13821.1    LBMM01002905    KMQ94203.1    KK855275    PTY21784.1    GBRD01015249    JAG50577.1    GBHO01026834    JAG16770.1    GECZ01005497    JAS64272.1    KQ414666    KOC65004.1    NEDP02001463    OWF53224.1    GL769399    EFZ10459.1    GECU01018727    JAS88979.1    KK107485    QOIP01000006    EZA50113.1    RLU21985.1    GEBQ01026937    JAT13040.1    KY765621    ARU12143.1    KQ971321    EFA00572.1    KQ981953    KYN32512.1    GEBQ01029068    JAT10909.1    NNAY01000450    OXU28303.1    GL888384    EGI61931.1    KQ976417    KYM89847.1    ADTU01021714    GEDC01001268    JAS36030.1    KY785190    ARS01452.1    GU046313    ADC80507.1    GL436428    EFN72028.1    AJVK01072089    AMQN01011485    KB308897    ELT96155.1    GL453744    EFN75588.1    KQ435689    KOX81292.1    GEZM01043995    JAV78593.1    KZ288458    PBC25501.1    GAKP01010306    JAC48646.1    KQ978260    KYM95875.1    GAMC01005036    JAC01520.1    ATLV01023929    KE525347    KFB49973.1    JRES01001294    KNC23876.1    KQ980530    KYN15649.1    GFXV01006283    MBW18088.1    DS235811    EEB17373.1    GGMR01015104    MBY27723.1    GBYB01012498    JAG82265.1    LJIG01009734    KRT82487.1    CAQQ02189998    GGFJ01010359    MBW59500.1    GDHF01003996    JAI48318.1    KQ982745    KYQ51384.1    GFDF01004179    JAV09905.1    KQ434893    KZC10645.1    AAAB01008986    EAU75759.1    APCN01003304    CH477418    EAT41295.1    OUUW01000009    SPP84837.1    AJWK01019210    PZQS01000009    PVD24821.1    AXCM01001727    CH379067    EAL31301.2    CH479202    EDW30121.1    CH902618    EDV38915.1    CM000159    EDW92726.1    AE014296    AY070975    AAF47391.1    AAL48597.1    CH954178    EDV50054.1    GGMS01010475    MBY79678.1    CH963876    EDW76859.1    CH480817    EDW49934.1    CM000362    CM002912    EDX07037.1    KMY96688.1    ABLF02021598    ABLF02021599    ABLF02021601    AK342483    BAH72492.1    ADMH02002043    ETN59794.1    DS232308    EDS39552.1    GFDL01012266    JAV22779.1    JXJN01004352   
Pfam
PF00160   Pro_isomerase
Interpro
IPR029000   Cyclophilin-like_dom_sf        + More
IPR020892   Cyclophilin-type_PPIase_CS       
IPR024936   Cyclophilin-type_PPIase       
IPR002130   Cyclophilin-type_PPIase_dom       
SUPFAM
SSF50891   SSF50891       
Gene 3D
PDB
1XWN     E-value=5.86896e-54,     Score=527

Ontologies

Topology

Length:
147
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00895999999999999
Exp number, first 60 AAs:
0.0002
Total prob of N-in:
0.14017
outside
1  -  147
 
 

Population Genetic Test Statistics

Pi
0.432462
Theta
12.16243
Tajima's D
-2.293198
CLR
18.569262
CSRT
0.00294985250737463
Interpretation
Possibly Positive selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号