SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00074
Pre Gene Modal
BGIBMGA012392
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.611
 

Sequence

CDS
ATGAATGTGGAAGGATTTAGAGGAAGAGGTAGACCTAAGAAGAAATGGATGGATTGTGTGAAAGACGATATGGGTAGGAGGGGAGTGAGCGAAGAAATGGTATATGATAGAAGAGTATGGAAGGAGCAAACATGTTGCGTCGACCCCAGCAATGTCAGGGGCCTACATAGCAACCTTGACGCCGTACACCACCACCTTGAGACGGCGCAGCCTGCCCTGCTTTTTTTAACGGAGACGCAGATATCTGCTCCGGATGATACCTCATACCTTGAGTACCCCGGCTACGTATTGGAGCACAACTTCCTGCGTAAAGCCGGGGTGTGCGTATTCGTCCGGGCTGATGTCTGTTGTCGCCGTCTTCGGGGCCTCGAACAACGGGACCTGTCCCTCTTGTGGCTGCGCGTAGACCACGGGGGCCGTAGCCGAATCTACGCGTGCCTGTACAGGTCCCACAGCAGTGATGCAGGTTCAGCTCTGTTTGAGCATGTGCAAGAGGGGACTAACCGCGTGCTTGAGCAGTACCCATCTGCGGAGGTGGTGGTTCTTGGAGACTTTAACGCTCACCACCAAGAGTGGTTGGGGTCCAGAACCACTGACCTCCCGGGTCGGACTGCCTACGATTTCGCCTTGGCCTACGGCTTCTCCCAGCTGGTGACACAGCCCACCCGTGTCCCAGATATCGAGGGGCACGAGCCTTCTTTGTTGGACCTTCTGCTGACCACAGATCCGGCCGGATACAGTGTGGTGGTCGACGCTCCGCTTGGATCGTCTGATCACTGCCTTATTCGTGCTGCCATACCACTCTCTCGTCCTGATCGTCGAACGACGACCGGGTATCGAAGAGTTTGGCGGTATATGTCAGCAGATTGGGATGGATTGCGTGAATTTTACGCATCCTACCCATGGGGGCGGTTCTGCTTTTCCTCTGCTGATCCTGACGTCTGTGCGGACCGTCTTAAAGACGTGGTGCTCCAGGGGATGGAATTGTTTATTCCCTCCTCTGAAGTGCCCGTTGGGGGTCGCAGCAGACCCTGGTATAACAATGCCAGCAGGGATGCTGCACGCCTCAAGCGGTCCGCATACGTGGCATGGGATAATGCCAGGAGACGTCGGGATCCTAACATCTCAGGGGAAAGGCGGAAATATAACGCCGCTTCCAGGTCCTACAAGAAGGTCTAG
Protein
MNVEGFRGRGRPKKKWMDCVKDDMGRRGVSEEMVYDRRVWKEQTCCVDPSNVRGLHSNLDAVHHHLETAQPALLFLTETQISAPDDTSYLEYPGYVLEHNFLRKAGVCVFVRADVCCRRLRGLEQRDLSLLWLRVDHGGRSRIYACLYRSHSSDAGSALFEHVQEGTNRVLEQYPSAEVVVLGDFNAHHQEWLGSRTTDLPGRTAYDFALAYGFSQLVTQPTRVPDIEGHEPSLLDLLLTTDPAGYSVVVDAPLGSSDHCLIRAAIPLSRPDRRTTTGYRRVWRYMSADWDGLREFYASYPWGRFCFSSADPDVCADRLKDVVLQGMELFIPSSEVPVGGRSRPWYNNASRDAARLKRSAYVAWDNARRRRDPNISGERRKYNAASRSYKKV

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF17921   Integrase_H2C2
PF09004   DUF1891
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR011011   Znf_FYVE_PHD       
IPR041588   Integrase_H2C2       
IPR013083   Znf_RING/FYVE/PHD       
IPR019787   Znf_PHD-finger       
IPR019786   Zinc_finger_PHD-type_CS       
IPR015095   AlkB_hom8_N       
SUPFAM
SSF56219   SSF56219        + More
SSF57903   SSF57903       
Gene 3D

Ontologies

Topology

Length:
392
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00023
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00957
outside
1  -  392
 
 

Population Genetic Test Statistics

Pi
10.855065
Theta
15.075524
Tajima's D
-0.841501
CLR
0.311848
CSRT
0.166641667916604
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号