SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00027
Pre Gene Modal
BGIBMGA002051
Annotation
PREDICTED:_dipeptidase_1-like_[Bombyx_mori]
Full name
Dipeptidase      
Location in the cell
Cytoplasmic   Reliability : 2.232
 

Sequence

CDS
ATGGCTCCAACGGAGCGTGTTTTCTGGTCGGCGTTCGTGCCGTGCGGTACCCAAAACAGAGACGCCGTCCAGCTGACTCTGGAGCAGATTGACGTCATCAAGCGACTTGTCGAAAAATACCCTCAGCAGTTGCAATTCGCTACCTCCGTAACTGATATCTTGCAGTCGCACGGTGCTCGCCCACGTAAGATAGCATCCCTGATTGGCATCGAAGGAGGTCACTCTATCGCGAACTCTCTAGCAGTCCTCCGGAGCTACTACCAGCTTGGGGTTCGGTATATGACCCTCACTCACACCTGCCACACACCCTGGGCGGACTCCGCGAACGAGGCTCCAGCAGCGAACGGACTGACGGACTTCGGAGAGAAAGTGGTCCGCGAGATGAACCGCCTCGGTATGATCGTTGATCTGTCTCACGTGGGGGAGAACTCAACCAGAGCTGCGATCAAGCTGTCGAAGGCCCCCGTCATCTTCAGTCACTCCTCTGTCTACAGCCTCTGCAACCATAACCGAAACGTACCGGATGATATTATAAAATCATTGAAAGACAACGGAGGCATCATAATGGTGAACTTCTTCCCAGACTTCGTGAAGTGTGCTCCTAACGCCACACTTTCCGATGTTGCAGAGCATTTCCACCACATCAAGAGATTGGTTGGTGCTGACTACGTAGGTATCGGCGGAGACTTCGACGGCGTCAACAGGGTTCCCCGTGGCTTGGAAGATGTGTCAAAATACCCAGAACTGTTTGCTGAACTGCTTAGGAGTGGACAGTGGAGCGTTCAGGAGTTAAAGAACTTGGCCGGCCTCAATATGCTACGTGTGATGCGACAGGTGGAAAAGGTCCGCGACGAAATGCGAACAAACGGTGTCGAGCCTGAGGAGCACCCGGACTCGCCCAGCGACAACGGCAACTGCACCAGCAATGCTTTTTACACAGAGAACGTTTAA
Protein
MAPTERVFWSAFVPCGTQNRDAVQLTLEQIDVIKRLVEKYPQQLQFATSVTDILQSHGARPRKIASLIGIEGGHSIANSLAVLRSYYQLGVRYMTLTHTCHTPWADSANEAPAANGLTDFGEKVVREMNRLGMIVDLSHVGENSTRAAIKLSKAPVIFSHSSVYSLCNHNRNVPDDIIKSLKDNGGIIMVNFFPDFVKCAPNATLSDVAEHFHHIKRLVGADYVGIGGDFDGVNRVPRGLEDVSKYPELFAELLRSGQWSVQELKNLAGLNMLRVMRQVEKVRDEMRTNGVEPEEHPDSPSDNGNCTSNAFYTENV

Summary

Catalytic Activity
Hydrolysis of dipeptides.
Cofactor
Zn(2+)
Subunit
Homodimer; disulfide-linked.
Similarity
Belongs to the metallo-dependent hydrolases superfamily. Peptidase M19 family.
Feature
chain  Dipeptidase
EC Number
3.4.13.19
EMBL
KQ460953    KPJ10333.1    KQ459599    KPI94332.1    AGBW02013269    OWR43719.1    + More
NWSH01000334    PCG77308.1    KQ980765    KYN13353.1    KQ976749    KYN08762.1    GL762140    EFZ21903.1    KQ981272    KYN43869.1    KQ976488    KYM83641.1    ADTU01006019    ADTU01006020    ADTU01006021    GL449799    EFN81957.1    KZ288400    PBC26257.1    KQ414627    KOC67480.1    AAZX01005844    DS235098    EEB11901.1    NEVH01006580    PNF37626.1    QOIP01000001    RLU26869.1    CM000361    EDX05362.1    KK107242    EZA54536.1    ACPB03008996    KB631899    ERL87010.1    CH940649    KRF81945.1    OUUW01000004    SPP79029.1    CH933807    KRG03677.1    CH379060    KRT04136.1    CH477344    EAT43028.1    CH902620    KPU73057.1    GBSH01000861    JAG68164.1    AE014134    AAF53659.5    CM002910    KMY90786.1    AHN54546.1    CH954179    KQS61940.1    KMY90785.1    EDV54796.2    GBSI01000721    JAC95775.1    AXCM01000160    AAAB01008859    EAA08208.5    APCN01000271    KQ971343    KYB27246.1    AXCN02001466    BC124623    AAI24624.1    AYCK01005495    AYCK01005496    CM000158    KRJ99088.1    CR382281    CU468003    UFQT01000071    SSX19398.1    AZIM01000835    ETE69165.1    CH964272    EDW84119.2    GDIP01103280    JAM00435.1    AERX01013846    AERX01013847    KK853032    KDR12256.1    CVRI01000047    CRK97751.1    GAMC01019979    GAMC01019978    GAMC01019975    GAMC01019971    JAB86580.1    DS235742    EEB16192.1    QOIP01000012    RLU15871.1    KZ288254    PBC30728.1    GBKC01000994    JAG45076.1    CM000160    EDW98637.1    CM000070    EAL28296.2    CH479182    EDW33969.1    BABH01012020    OUUW01000007    SPP83284.1    NEVH01006576    PNF37768.1    ADMH02002018    ETN59976.1    KK852779    KDR16715.1    GDRN01070938    JAI63790.1    ODYU01012538    SOQ58912.1    JRES01000664    KNC29438.1    NEVH01009089    PNF33643.1    DS469682    EDO35966.1    AE014297    BT010258    BT031191    AAF56581.2    AAQ23576.1    ABY20432.1    CH954182    EDV53555.1    KQ414610    KOC69236.1   
Pfam
PF01244   Peptidase_M19
Interpro
IPR008257   Pept_M19        + More
IPR032466   Metal_Hydrolase       
IPR000180   Dipep_AS       
IPR028536   Dpep1       
SUPFAM
SSF51556   SSF51556       
PDB
1ITU     E-value=1.3977e-87,     Score=822

Ontologies

Topology

Subcellular location
Membrane  
Length:
316
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0780399999999998
Exp number, first 60 AAs:
0.00036
Total prob of N-in:
0.01910
outside
1  -  316
 
 

Population Genetic Test Statistics

Pi
18.964123
Theta
23.110051
Tajima's D
-1.496208
CLR
0
CSRT
0.0599970001499925
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号