SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO00002
Pre Gene Modal
BGIBMGA014537
Annotation
PREDICTED:_uncharacterized_protein_LOC101742912_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.716
 

Sequence

CDS
ATGGACAATACTATCCCGAAAGACCTGGAAGTCATAGTGGACAAACCGTCAACAGTAAGGCGGAGTATTGAAAATATTGAGGCAAGCCAGGAGGCAGCACAAATAGAAGTCCAACCCTCCCAAAAAAGGATCCAAGCGATCAAATCCAGCCAGAAGGAGGCAACCAGGAAAATAGACCTGGTTACGTCACCTCCAACAAGGGAGAAACACCCAACCCTGGCTCTTGAAGCTAAATCCTGTCTTTGCAAGGCGAAGACTTATCTGGCCAACTCCAGAAACCTGAGGACGGACATAAAGGACGGAGTCTTGAATACAATCGATAGACTGTACCAAATAGTCAAAACTTTGGATAAAGAATTGGAAAATCAAAAAAGAGGAAAGAAAGAGGAGGAGAAAGGAGTAGGGACGGAGCTGCGACGGCTTATTGCTGAGGGCGACCACAGAGGACAGCATGGCACACCATCCCGCAGTCACAGTCGGTTGGGGATGCTCGGCTGCGGTGGCGTACCAACGTTTCAGATTGTGAGAGAAGATGGGGTGCTTAGCAGTGTGGTCCACGTCGCTTACTGCTCCGGTCACAACTGTATCATGCTTACTCTAACGAAGGAAGGGTCAAGAAACATGCCTAAGGCGAGCACAACCAGGAAATGTAACACCAGGGACGTGAATTGGCTACCTTTTATTGAAAAGGCAACCCAATTCAAGAGGGACAAAAATCTTGACACTCAAAGATTGAAAATGACAAACACGGAGGAAGAACGAACGAATACCATAAACGAGTATGATGCAGTTGTGATCGAGGCGCACGAGGAGGTCTTCCCAAAAATAAAATGTAAAACAAATCCGAAGATTCCTTGGTGGACCAAAGAGTTGGAGGATAAGGAAAAGGAAACACTTACCTTAGAGTGGCGGGTCCGCTGCACGGAACCCTGCAGTAGGAATGCCGCCGTAGCCGGGTATCTGGAACAAAAAGAGGACTGTGGAAATGATGTGAAGGGTGCTGAGAGAAGCAGTTGGATGGAGTTTGATTTTGCAAAATTGGAACAACTTACTGTCAAGACTAGATAA
Protein
MDNTIPKDLEVIVDKPSTVRRSIENIEASQEAAQIEVQPSQKRIQAIKSSQKEATRKIDLVTSPPTREKHPTLALEAKSCLCKAKTYLANSRNLRTDIKDGVLNTIDRLYQIVKTLDKELENQKRGKKEEEKGVGTELRRLIAEGDHRGQHGTPSRSHSRLGMLGCGGVPTFQIVREDGVLSSVVHVAYCSGHNCIMLTLTKEGSRNMPKASTTRKCNTRDVNWLPFIEKATQFKRDKNLDTQRLKMTNTEEERTNTINEYDAVVIEAHEEVFPKIKCKTNPKIPWWTKELEDKEKETLTLEWRVRCTEPCSRNAAVAGYLEQKEDCGNDVKGAERSSWMEFDFAKLEQLTVKTR

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
355
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.02136
Exp number, first 60 AAs:
0
Total prob of N-in:
0.01833
outside
1  -  355
 
 

Population Genetic Test Statistics

Pi
0.385614
Theta
0.409466
Tajima's D
-1.130915
CLR
0.386027
CSRT
0.155042247887606
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号